CAZyme Information: MGYG000000925_00135

Basic Information

• Species: Collinsella sp900544115
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900544115
• CAZyme ID: MGYG000000925_00135
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		30753.97	6.0865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000925	947873	MAG	China	Asia

• Gene Location: Start: 141801; End: 142604 Strand: -

Full Sequence      

MNEKHIPKVIHYIWFGNNDLPEEAVACIESWKKFCPDYEIKRWDESNFDLSSNNYVKQAY
EAKKWAFVSDYARLWILVNEGGIYMDTDVEVLKSLDPFLTNHAFSGFESDSSVPTGIMAC
EKGFPLFRKLLNDYDVRSFIKSDGSYDLTTNVVVITKACKALGLKLDNTMQIVDGFTLYP
SDWFCPKSHESGDIHLTENSVTIHHFNGSWIDEVEQGLLKERRCFLTRHSWVNPMLAGLI
VRLQYGFKTNDFKPLTSALKAFFANRN

Enzyme Prediction     

No EC number prediction in MGYG000000925_00135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	26	101	2.2e-25	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.32e-23	6	131	82	211	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.78e-16	21	104	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	9.65e-11	2	134	39	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	7.40e-04	51	116	156	215	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT95860.1	6.81e-97	6	216	2	212
BBK91625.1	1.24e-96	6	216	2	212
AST53065.1	1.11e-95	6	216	2	212
QJE27088.1	2.33e-93	6	216	2	212
QYR65866.1	3.29e-84	6	242	2	231

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	5.39e-11	6	133	57	187	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P38287	1.29e-07	6	131	62	190	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q5UQW4	2.09e-06	6	188	2	193	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
O14084	2.12e-06	6	104	64	168	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
P33300	4.40e-06	6	140	55	195	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000925_00135.