CAZyme Information: MGYG000000922_02614

Basic Information

• Species: UMGS416 sp900542005
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UMGS416; UMGS416; UMGS416 sp900542005
• CAZyme ID: MGYG000000922_02614
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698		77996.58	6.2809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000922	2901170	MAG	China	Asia

• Gene Location: Start: 2795; End: 4891 Strand: +

Full Sequence      

MRIVSFEENGIHFAFTAEPGKPALLLHCSAMAFDLALLHPGARPFMNMAQVHAAGENQAD
HHGSKHTGNMPSGRLVYEAHRDEQNGYGRKLTVFQRADAVTVISHYQFYRGIPVVRAWTE
VVNGQQEPLGLEYVASFALTGLEKEGLLPWQDKMRIAVPHNTWAYEAQWQRYTLPELGLY
PKNDFSLKRIAYSSTGSWPTSEYLPMGYLENTQCGTSLLWQIETNASWSWEISDLDGHLY
LQLSSASQQEGHWYKQLGKGESFCSDPVAIAAVPGAMDEAVGALTRYRRVIRRANEDNEA
LPVIFNDYMNCLMGDPTTQRELPLIRAAAEAGCEYYVIDAGWYSDGPWWDGVGEWLPAPG
RFPGGLKALLDEIRRHGMVPGLWLEIEVMGIHCPLAQAVPKDWFFCRHGKPVMDHDRYQL
DFRHPDVRAHADAVVDRLVQEYGVGYIKMDYNINAGVGTERSADSFGDGLMGHTRAYLAW
LDGVFARYPKLVIENCSSGGMRMDYALLARHSIQSTSDQTRYLAYPSIAAASPTAVTPEQ
SAVWSYPLADGSVEETVFNMVNAMLLRIHQSGHLANLSPERFAVVREGIAYYKSIRSLIP
QGLPLWPLGLPRMGDPWVCFGLKAQGKIFLALWRLSSAGPDITLPFPGLRGRQVQVSCSF
PSFSRTRFQWNAAAGSLSVIMDEPNTARLFELSYGESL

Enzyme Prediction     

No EC number prediction in MGYG000000922_02614.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	90	613	5.4e-91	0.7427325581395349

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.25e-93	300	593	1	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	6.46e-33	278	602	13	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	1.74e-19	315	602	305	592	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	2.43e-07	305	468	5	140	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH18865.1	1.01e-309	4	692	6	696
QJD84463.1	7.75e-307	4	692	6	696
BBI32739.1	1.93e-298	4	692	10	699
QKE72774.1	2.02e-298	2	693	10	704
ASS97000.1	2.33e-296	2	693	10	704

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	5.02e-17	257	651	284	675	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]
6JHP_A	6.95e-14	257	520	314	583	Crystalstructure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27756	1.15e-19	288	637	310	662	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
Q0CEF5	2.28e-17	114	650	155	679	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1
B8NWY6	5.42e-17	93	650	159	705	Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglC PE=3 SV=2
Q2TW69	5.42e-17	93	650	159	705	Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglC PE=3 SV=1
P43469	2.75e-16	324	508	345	532	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000922_02614.