CAZyme Information: MGYG000000917_00972

Basic Information

• Species: Phascolarctobacterium sp900551745
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium; Phascolarctobacterium sp900551745
• CAZyme ID: MGYG000000917_00972
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		43603.17	5.1404

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000917	1546935	MAG	China	Asia

• Gene Location: Start: 4303; End: 5487 Strand: -

Full Sequence      

MKRIFLAGKGLAFIVFITVFLFTGCGQSAESKSEVKNPTLHDAAVKMVAGMSLEEKIGQM
LLIGIDGKEIDEGALSMLRDYHVGGVILFDRNMNNKYQVTGLNANLQRLNKEYNKLPLYL
CVDQEGGMVARMKQGLTVAPAAARMAEQGTPEDARRWAYQTAMELETIGFNVNFAPVLDI
GIPYERSYGHDAASVSKFTEAVCRGYDQAGIIYSLKHFPGMGKSEVDPHTEQYRITASKE
ILLQEDAIPFKNIIQNFDNQDFMVMVGHLIYTGLDTLPASVSPQVINNFLRNELGFQGII
ITDDMEMGALTSMYGFREMGVAAVQAGVDILLVCHNYEHQQQVYQGVLEAVKTNKLTTAA
IDAAAVRIVENKMIKLLDAGKQQELLQDLQKEAQ

Enzyme Prediction     

No EC number prediction in MGYG000000917_00972.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	333	3.3e-49	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.07e-76	51	393	1	333	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.64e-75	52	370	1	315	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.82e-60	60	336	3	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	3.84e-12	42	371	35	351	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBG62799.1	1.69e-278	1	394	1	394
QNP77560.1	1.39e-277	1	394	1	394
CBL06667.1	2.44e-109	21	376	27	383
SNV01291.1	5.05e-109	21	376	26	384
BDA09432.1	5.57e-108	21	376	27	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	7.55e-67	51	380	11	345	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.72e-47	52	372	8	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3TEV_A	6.57e-42	58	359	19	318	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3BMX_A	5.13e-40	13	373	5	394	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GVF_A	9.44e-39	61	357	4	301	Crystalstructure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVF_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0BQ51	2.08e-43	60	347	1	291	Beta-hexosaminidase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=nagZ PE=3 SV=1
A3N1B7	2.91e-43	60	347	1	291	Beta-hexosaminidase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=nagZ PE=3 SV=1
B3GXZ7	2.91e-43	60	347	1	291	Beta-hexosaminidase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=nagZ PE=3 SV=1
B2FPW9	1.23e-42	60	361	1	300	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
C5BFM6	1.93e-42	61	336	4	281	Beta-hexosaminidase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000040	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	24