CAZyme Information: MGYG000000902_04001

Basic Information

• Species: Clostridium neonatale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium neonatale
• CAZyme ID: MGYG000000902_04001
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000000902_97|CGC1	41453.17	8.8772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000902	4770522	MAG	China	Asia

• Gene Location: Start: 7203; End: 8306 Strand: +

Full Sequence      

MKKVLILTTSTGQGHNQAASSVEESFKACGYETIKYDFLAKNSTLLNDIIVLGYEFLAAK
FPKLYGFFYKISNQKFTNKLLKIPFYLNSKKVVKVLNDIQPDLIVASHAFSINVLENCKK
KGLKAPYILIVTDFNAHYTYVSNYVDAYITGSEFTKKTLINKGISPERIYPIGIPISQKF
YTEITEANELKDEYFNLLLMSGSLGLNSISIVLKELLKNKNRLRITVVCGKNTKLRDKLL
NYCNDNNFENKKLHILGFTKDVSYLMDYCDIIISKPGGLTVTESIVKNTPLVIPFAIPGQ
EQENIDFLVNEGYSILLSDINDINEVVNRLIDNKAILLDIKSKLQSLSSTYSTKKIVEIG
ENLINEL

Enzyme Prediction     

No EC number prediction in MGYG000000902_04001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	197	347	1.2e-26	0.9554140127388535

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	2.12e-72	4	365	1	364	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	4.01e-47	2	358	5	363	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	6.63e-33	3	366	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13608	PRK13608	1.37e-32	2	365	6	370	diacylglycerol glucosyltransferase; Provisional
pfam06925	MGDG_synth	1.41e-25	15	176	1	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUU45633.1	1.86e-181	1	366	1	367
BCZ44492.1	7.53e-181	1	364	1	365
AQS03034.1	3.06e-180	1	366	1	367
QES71695.1	1.24e-179	1	366	1	367
QUF74587.1	1.24e-179	1	366	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	1.22e-18	2	327	6	346	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]
7D1I_A	2.84e-06	167	363	160	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65IA4	1.08e-38	2	366	5	375	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
P54166	7.75e-38	2	358	5	363	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
A8FED1	2.97e-37	2	358	5	363	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
A7GKY0	2.37e-35	3	359	6	364	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) OX=315749 GN=ugtP PE=3 SV=1
A9VSQ8	1.22e-34	3	347	6	352	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus mycoides (strain KBAB4) OX=315730 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000902_04001.