CAZyme Information: MGYG000000892_00162

Basic Information

• Species: CAG-115 sp002492075
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp002492075
• CAZyme ID: MGYG000000892_00162
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000000892_5|CGC1	43224.77	4.6505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000892	2629881	MAG	Denmark	Europe

• Gene Location: Start: 10152; End: 11288 Strand: +

Full Sequence      

MNYEQIDRYVERLLEGSTPDAPLWNIESIRKGKEPHWNYIDGCMITALLCAAEITGEEKY
ADFAERFIDYYVAEDGSIRGYSQEKFNLDDVNEGRVLFDLYGKTGKEKYKKAILLLHEQL
EKQPRTNTGNFWHKLIYPNQIWLDGLYMAQVFSVRFQKEFGDGDYSDAVSQFKNVRRLMF
DENKNLYYHGCDCSKMAFWADKNTGCSKNFWLRAIGWFCISLIDNIDYLDDENAKKELCA
IFSEAIDGIAQYADTETGMFWQVVDQGGRDGNYLETSGSSMIAYAMMKGARLGVIDGKYA
AMGKKTFDGICEKYLSVNDSGELDLGGICLVAGLGPEDNRRRDGSYEYYVSEPIVNNDAK
GVAPFVLCYTEVKRMDKR

Enzyme Prediction     

No EC number prediction in MGYG000000892_00162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	374	5.9e-106	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.42e-84	36	374	33	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.26e-77	29	375	19	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.006	37	122	412	503	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU22672.1	1.27e-201	3	374	7	378
SIP63207.1	1.10e-173	3	375	2	373
CCV66002.1	3.91e-162	6	372	4	372
QTE68952.1	2.74e-149	3	374	13	382
CBL09353.1	9.70e-148	4	376	2	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.06e-93	36	375	22	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.87e-62	37	373	39	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.21e-61	37	373	29	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.65e-12	38	375	81	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.57e-61	37	373	39	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.44e-40	156	371	5	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.44e-40	156	371	5	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	6.99e-14	37	292	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000892_00162.