CAZyme Information: MGYG000000884_02035

Basic Information

• Species: CAG-103 sp900317855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-103; CAG-103 sp900317855
• CAZyme ID: MGYG000000884_02035
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763		83034.34	6.1361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000884	2163347	MAG	Denmark	Europe

• Gene Location: Start: 21; End: 2312 Strand: +

Full Sequence      

MAAAAAIRPGMAHTRRTLPLLPPPGDRRYLPTGADAHWDDDGTVSFTGLPPRAWSQVLTN
GRFGYLATDAGTGHMWHRNAHTGRINRWLCDPWVLRGTETLRMASRAGAVSLFDDDGTAR
VEYGFGWAAWERSVDGMSVRVTAFVPEDADARVLLIECAGRARITWHTDLVCAGRDADAP
AVVTAFADGMLTAENVRADAPELFCAAAGMPLAGWTCDRFSFLRGQMDARAGAGLSPCFA
LEGTVDRQGVIVCGCDTRANLLRLTQPDEAAHALRATRERWLGAVSRLWMTTPDADMNRY
LGGWAAYQTLCCRLLARTSLYQNGGAFGFRDQLQDAVNLLLLDSKPAREQIGRACAHQFA
AGDVCHWWHAGVGAEHGVRTRISDDLLWLPWAVCEYVEKTGDAEILSAEYPFLAGEALEE
NEHDRYQPLEAGAETGTVLEHCRRALMRVLARGVGAHGLLHIGTGDWNDAFDRVGAQGRG
ESVWLTWFFAVTARKFAALVGGHAAGQLCLAADHCTRAAEDAWDGAWYRRGYYDDGRPLG
SAESDECRIDAIAQAFAALDTHADPGRVQTALTSAVAQLFDREHNVVRLFDPPITRRTPE
TGYVRSYGAGLRENGGQYTHGALWLAMALLRTGRTAEGAEILHAVLPTAHDPARYEGEPY
VLAADIAGGDNAGAAGWTWYTGAAGWYLRIAAEDLLGLHLRGGVLYPEPHLPAGWPECTV
RWRDGAGLLHTIRLRPDGVTVDGEAYDGGGIGKKRPKPYSQDR

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	50	751	2.1e-173	0.7123552123552124

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	2.24e-138	51	754	293	1041	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.62e-73	281	698	2	424	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
cd11756	GH94N_ChvB_NdvB_1_like	2.26e-19	50	266	28	281	First GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This first of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.
pfam06165	Glyco_transf_36	2.45e-17	51	246	1	233	Glycosyltransferase family 36. The glycosyltransferase family 36 includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-). Many members of this family contain two copies of this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBB66089.1	7.37e-184	13	749	1713	2383
QXD15157.1	1.95e-146	41	751	349	1119
AFL72793.1	3.73e-145	38	752	329	1083
AKH43957.1	3.06e-140	51	740	1962	2698
APV50312.1	1.44e-139	51	748	2068	2815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CQS_A	2.80e-37	242	760	296	830	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3AFJ_A	1.17e-36	242	760	296	830	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3ACT_A	2.06e-36	242	760	296	830	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]
3ACS_A	4.83e-36	242	760	296	830	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127]
3S4C_A	4.44e-35	259	748	293	804	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	2.25e-122	51	737	2073	2808	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	1.06e-37	263	748	291	794	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q92AT0	2.66e-07	304	499	584	770	1,2-beta-oligoglucan phosphorylase OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=lin1839 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999003	0.001015	0.000003	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000884_02035.