CAZyme Information: MGYG000000825_02066

Basic Information

• Species: Duncaniella sp900544535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp900544535
• CAZyme ID: MGYG000000825_02066
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
995		109579.19	6.1639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000825	2700478	MAG	China	Asia

• Gene Location: Start: 32374; End: 35361 Strand: +

Full Sequence      

MIKGIQILTAGLLLASGVVMAAPPDGFPRSMQDRPRKERQRNIVPSQWVRPSVAAFPGAE
GFGMWTTGGRGGKVYHVTTLEDTDAPGSFRYACNQTGPRTIVFDVDGTIFLKSPLRMENP
DVTIAGQTAPGDGVCIADYPFSIQADNVIVRFMRFRLGDREVAHHEGDGLGGSGHRNVMV
DHCSVSWSIDECISVYGMRDFTVQWCIASHSLHNSGHQKGPHGYGGNWGGSGASYHHNLI
ANHTSRTPRLGPSPHTQTDERMDLRNNVIYNHGSNGCYGGEGMTVNIVNNYFKPGKTTNT
MPERIAGPGIRTVQYCLDGRGLAEDYNSLFGTSLTRDDVKGLRKGGAAKGVNRVSIAGRT
FDIDMADNSIEVDGRKIKVGWNVWRPMLHKWGQFYVDGNVNHDIAAVGGDNWKTGVLRQI
NPENCDGYWDKSIAAAIKLDSPMDFETVTTHSAAEACDRVLDCAGASLHRDAYDELVIRD
VRDGSATFGNNGIIDSQNDIVYPDGSRGWPALRSGASRTDSDSDGIPDEWEKAHGLNPDD
ASDGSRLTKLGYTNLELYLNSLVADIVEAGLKGGTPCAQIRETSSSDFGRKFEERTLRLD
YLFTATPSGERGVALSGQSYMDGWAGRRHRMAELPLRGNGIVTVVSEADGDTLYRTSFSS
LYHEWLTTDEAATTSKAFEHTVLLPYPSAPALITVELLDNRQRPMASMTHRFRPDDILIA
RKGHGRVAEHRYLHRGGDPKEAIDVAILAEGYTRAEMDSFYRHARTAVEAILSYEPFKSR
ADKFNFVAVATPSEDSGVSVPRLGEWRSTAFSSHFSTFYSDRYLTSLHVKDINDALSGIP
YEHIIILANTPEYGGGGIYNSYTLTTARHKQFRPVVVHEFGHSFGGLADEYFYESEANEE
AYPTEVEPWEPNITTLADFKGKWENLIPKDAPRPTPVSEAAKWPVGLYEGGGYVSHGVYR
PADNCRMRTNTAPDFCPACRQALCRLIDFYTGDEL

Enzyme Prediction     

No EC number prediction in MGYG000000825_02066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	107	292	3e-76	0.9890710382513661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09471	Peptidase_M64	6.03e-100	732	987	1	259	IgA Peptidase M64. This is a family of highly selective metallo-endopeptidases. The primary structure of the Clostridium ramosum IgA proteinase shows no significant overall similarity to any other known metallo-endopeptidase.
pfam16217	M64_N	3.35e-44	592	704	4	115	Peptidase M64 N-terminus. This domain is found at the N-terminus of IgA Peptidase M64. Its function is unknown.
COG3866	PelB	3.05e-05	66	250	48	236	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	1.00e-04	100	292	3	186	Amb_all domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD39200.1	5.20e-180	53	574	26	565
QCP72891.1	5.20e-180	53	574	26	565
QUT75603.1	1.13e-164	44	586	6	512
QUT77823.1	7.83e-162	53	568	51	520
QUT93111.1	3.32e-159	53	563	43	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4DF9_A	9.17e-166	585	992	2	408	Crystalstructure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution [Bacteroides fragilis NCTC 9343],4DF9_B Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution [Bacteroides fragilis NCTC 9343],4DF9_C Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution [Bacteroides fragilis NCTC 9343],4DF9_D Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution [Bacteroides fragilis NCTC 9343],4DF9_E Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution [Bacteroides fragilis NCTC 9343],4DF9_F Crystal structure of a putative peptidase (BF3526) from Bacteroides fragilis NCTC 9343 at 2.17 A resolution [Bacteroides fragilis NCTC 9343]
3P1V_A	2.32e-162	587	990	3	405	Crystalstructure of a metallo-endopeptidases (BACOVA_00663) from Bacteroides ovatus at 1.93 A resolution [Bacteroides ovatus ATCC 8483],3P1V_B Crystal structure of a metallo-endopeptidases (BACOVA_00663) from Bacteroides ovatus at 1.93 A resolution [Bacteroides ovatus ATCC 8483]
6FI2_A	1.18e-07	60	215	46	193	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	1.86e-32	52	563	19	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	6.14e-32	52	563	19	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q4WL88	1.53e-31	52	563	20	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	2.06e-31	52	563	20	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q5B297	2.10e-31	43	565	10	413	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000322	0.998924	0.000196	0.000182	0.000166	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000825_02066.