CAZyme Information: MGYG000000813_02013

Basic Information

• Species: Zag1 sp000437435
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1; Zag1 sp000437435
• CAZyme ID: MGYG000000813_02013
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662		76636.16	8.7606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000813	1978596	MAG	China	Asia

• Gene Location: Start: 133028; End: 135016 Strand: +

Full Sequence      

MFEWDLRKRVIAGAIAFGVLSTGLCFALVYQSPAKTDEIYSAALKDFEDGDYQNAYYLFS
KIGLFSNLKPISIYHRAECARMLDDDKSELKQYQLLFNNYPKHKLSIRSRYLAGQKLVKD
RPQLAKKYFEYIIHNAPDTDYAIASDYYLGVILKNKYENAKIFPQSVKDDMQNHFRHYIE
KAPSGKLALNAVNDWLSIDADISKDDSLLMAKTCYLFGEYEKARELLNKTDVSEAWALDV
KNSYALKNYSRAKYLTENGLNKHAQYVSEDDIIEAVDIYTNLAESKTKAVDRLLGISTGK
GRDYLLNLKCQGVSQNDKTTCYSHLYLKYPNGRFSADALSNIFFAKIKLKDYENAKKIGR
DHLNKFPNSNSAPMVMYWMGKLAEKTNNYQEYTSYYKSVIDKFPDSYYAYRAYLKLSRIN
GPLVTDYINPKPVVYPYKYAHNNIIVKLVELKDYDIVSELADNDDFVKSWVLYKKGDYSH
SMLVARDAMEKMQDKPDKYDLRWRLVYPVIFYDDIKKYANEAGNNPPLMLALTREESYFD
PLAQSLVGASGLMQLMPSTASEINSKYKLGMNISYALFNPCSNIKLGNYYYNFLRKNLEG
HDISSVAAYNGGIGSIQRWKTSLHYNDTDEFVEQIPYIETQNYVKKVFRSYWNYIRIYNG
NN

Enzyme Prediction     

No EC number prediction in MGYG000000813_02013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	521	653	1.9e-25	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	3.09e-50	507	654	2	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.50e-37	508	651	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	9.34e-28	507	662	135	291	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	4.82e-27	526	652	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK11619	PRK11619	4.25e-23	507	647	475	617	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39013.1	0.0	1	662	1	661
QLE57847.1	1.11e-44	316	659	347	713
QMS87397.1	1.22e-43	315	659	347	711
BAY72086.1	4.11e-43	322	659	354	711
BAB73069.1	4.11e-43	322	659	354	711

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.07e-18	501	650	406	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.10e-18	501	650	410	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.14e-18	501	650	416	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.16e-18	501	650	420	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.19e-18	501	650	426	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	9.50e-17	507	654	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	9.50e-17	507	654	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	1.89e-14	507	660	476	630	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	2.28e-14	418	647	339	565	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.75e-12	515	652	64	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.952605	0.027185	0.015349	0.000397	0.000203	0.004266

TMHMM  Annotations     

start	end
12	34