CAZyme Information: MGYG000000796_00506

Basic Information

• Species: Turicimonas muris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Turicimonas; Turicimonas muris
• CAZyme ID: MGYG000000796_00506
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
161		17840.6	8.6416

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000796	2621918	MAG	China	Asia

• Gene Location: Start: 93476; End: 93961 Strand: -

Full Sequence      

MIPLTHKIASVLIGFLIYGLQPVFADCFDIHGRNFGVAPDLLRAIAITESSGNPSAVAGP
KCSQDIGLMQINSQWLSKWNLSKSELLENACLNIEIGARILKDNLMRFDNPWEAVGAYNA
GCSRLKGQNCTDARQKYAWRVFKNLQSLDDKTREKLKAIAS

Enzyme Prediction     

No EC number prediction in MGYG000000796_00506.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	38	151	3.9e-20	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	5.72e-39	35	147	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	1.39e-29	11	155	5	149	type III secretion system invasion protein IagB.
pfam01464	SLT	4.04e-23	32	126	5	100	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	2.96e-19	26	147	21	147	lytic transglycosylase; Provisional
cd00254	LT-like	2.05e-17	39	146	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU65299.1	2.57e-109	1	161	1	161
QQQ96454.1	6.38e-107	4	161	1	158
ABM41737.1	9.37e-32	25	161	19	164
QBM28515.1	6.19e-31	25	161	12	157
AEB85147.1	8.13e-31	21	148	15	149

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.40e-11	26	105	2	86	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43018	2.24e-21	20	154	14	148	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
E1WAC2	4.46e-21	20	148	14	142	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	4.46e-21	20	148	14	142	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P14499	1.32e-18	25	143	20	140	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
Q07568	1.76e-18	25	143	18	136	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000232	0.999192	0.000149	0.000142	0.000134	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000796_00506.