CAZyme Information: MGYG000000793_00915

Basic Information

• Species: Succinivibrio sp900548485
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900548485
• CAZyme ID: MGYG000000793_00915
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638		71359.84	9.3269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000793	1894833	MAG	China	Asia

• Gene Location: Start: 108; End: 2024 Strand: -

Full Sequence      

MPKLDRYEQRSLAVYDREDNLIAYNLTSDGYLRLKSTVSEVDPLYLKLLLASEDKRFNYH
LGIDPLAIIRAFFSNLKAKSTVSGASTIAMQVARNLDKDLRYGYYNKLRQALAAIYLTCT
LGQEEILNIYLSTVPMGGNLEGVKAASLAWFGHLPDRLTPAEAALLVALPRSPEKLRPDK
FLKSARYYRNDVLRLGVANGVIAKDIAETATKEALPEKMQKIYQDALCLKNFFKTPEVYE
YHTNLDPKIQELLKKTSKDYLQEQNSFETLAAVVINNKTFEVVGYLGSANTATSLMDLPH
ALRSPASTLKPFVYAKAFDSGLLHPKTIVYDEKERFGAWAPVNYSHKFHGAITASDSLAN
SLNLPTLDIILKLGPQRFFLWINSPKNWVKLAKNTTPHAGISLGAASTSLFDLANFYAAL
ANDGIYETARLLKSEERSTKYKLLSESSARATYEILKKVRRPDFAPKSEISYKTGTSYHH
ADAYAIGSLYDYTAAIWVGRPDNRPMTMMKTGFSAASPHLFKLLESIPQQRIPKVPLKEI
GALSKDAPLYLRTIKNPQTKNEPLKIDFPQNGSIVKPDFYGNIYVLTKNTQGEVIMTING
EIAPDTSFAPQHEGFYNVCVADENGQSDCVNFKVILNH

Enzyme Prediction     

No EC number prediction in MGYG000000793_00915.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	36	194	1.6e-41	0.8926553672316384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4953	PbpC	4.13e-148	2	553	27	588	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK11240	PRK11240	1.43e-96	28	536	57	574	penicillin-binding protein 1C; Provisional
COG0744	MrcB	2.79e-92	11	542	55	610	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.94e-84	49	518	18	519	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	9.87e-53	49	518	83	709	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUN31587.1	5.99e-111	2	634	20	667
AWM88171.1	4.67e-106	8	634	46	702
APX22074.1	2.88e-104	14	634	34	664
ALV30316.1	9.12e-104	1	634	26	696
QOZ17639.1	2.14e-103	4	634	48	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	4.47e-28	10	546	133	712	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	4.67e-28	10	546	154	733	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
2OQO_A	5.23e-26	33	213	20	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.81e-25	33	213	20	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2JE5_A	2.17e-25	11	535	33	640	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76577	1.77e-76	28	520	59	557	Penicillin-binding protein 1C OS=Escherichia coli (strain K12) OX=83333 GN=pbpC PE=1 SV=1
P38050	1.14e-35	37	522	71	591	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
Q9KUC0	1.16e-33	3	516	149	703	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1
O66874	4.30e-31	33	518	63	658	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P45345	5.00e-31	26	516	161	693	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000793_00915.