CAZyme Information: MGYG000000775_00636

Basic Information

• Species: Bifidobacterium sp900551485
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium sp900551485
• CAZyme ID: MGYG000000775_00636
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1133	MGYG000000775_11|CGC1	127382.23	4.3879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000775	1891758	MAG	Japan	Asia

• Gene Location: Start: 6744; End: 10145 Strand: -

Full Sequence      

MFIPRYYEDLDVLHVGCEPPRSYFIPASHPTDTRFAAREQSDRFQLLNGEWSFRYYASIY
ELDDAVRASQSQHEPVFFEPMFNPDESFTLLNVPSVWQMNGYDHNQYTNTRYPFPFDPPH
VPADNPCAVYRTMFDYTPDSAAPRAYLNFEGVDSCFYVWLNGDFVGYSQVSHCTSEFDVS
DLVEEGENTLAVLVLKWCDGSYLEDQDKLRMSGIFRDVYLLTRPQHAIRDYYVRQSVDLN
TNSADISIDFDYLDDIAPRAIDVILGDAAGNIVAQSSPQQASADCAFPTKSRALLHVEQP
TLWNPEEPYCYTLIIVSEDESICQPLALRDITVDAPDGMHQRVLLNGKPIVIHGMNRHDS
DPVTGYTISPQQFENDLLLMKSHNVNGVRTSHYPNAPHYYDLFDELGFLVVDEADIEAHG
AADVVLPPSENGEPAADWERAQYVWNEPIANNPAFSGAILDRVQRLVERDKNHGSVIFWS
MGNESAYGVGFERALAWVKTLDGARLTHYESARYVERGGTERHDYLNIDVHSRMYPSIAE
LDGYFDAHGPQGDGANGEDGSIPVSSETDDRKTGHHETARAGQVKPYLMCEYCHAMGNGP
GDLEDYFQCIQRHDGLLGGYVWEWCDHAVFAGRNAQGRREYLYGGDFGEWPNDGNFCVDG
MVSPDRTPHSGLDEFKNVFRPARIEAFDSECGVARLHNYFDFRELGDAVVLMWEVYVDGV
MQTYSLVEPTDALQIAPHCSGDVELSGWQDAAIDQPGRVTLVLRYLAREARWGQDQLFEL
GFDEIDVPNPTGDDSSQWVRHQIEDMLAGDEIGDAIVLREHGAQIEVTGADWRYIFDKRT
GLFDSMSYRNRQILGAPMTIDIWRAPTDNDRNIRHAWERAGYDRATTRAYSVQMRTVASS
GIADGADTAAANADDMDVSGVAMAVNAVELRCDMAVVAPTVQPIARITATWTIHADGSVA
VKMDVRKDPAFPFLPRFGVHMRLLKTMRDVTYCGFGPNESYIDKHRSCWHGVFTGTPDTL
YEAEIKPQENGNHHDCSWASISGEGAGLMIVNGDGSDEPERTGFDFQALPYTAAEMTRKA
HDFELERSEFTEVSVDYMQSGIGSNSCGPELLPQYRLDADRFTFAVTLRPQSL

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	35	1008	4.6e-199	0.9694148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	36	1131	42	1027	beta-galactosidase.
PRK10340	ebgA	0.0	7	1130	4	999	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	3.49e-110	44	693	12	568	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	2.14e-83	344	684	9	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	2.82e-76	828	1128	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGW84495.1	0.0	1	1131	1	1150
AGO51768.1	0.0	1	1131	1	1150
AFJ17588.1	0.0	1	1131	1	1150
AXQ18745.1	0.0	1	1131	1	1150
AIA32311.1	0.0	1	1131	1	1150

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	3.77e-162	3	1129	1	981	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	5.14e-162	4	1129	1	980	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
3DEC_A	3.89e-130	20	1130	20	996	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	4.89e-130	20	1130	23	1000	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
1YQ2_A	9.43e-128	47	1130	36	1023	ChainA, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	5.54e-250	1	1122	1	991	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	1.33e-207	1	1129	1	992	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
Q56307	2.06e-161	3	1129	1	981	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	3.17e-154	4	1130	18	1033	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
P06864	5.36e-147	7	1132	4	1001	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000775_00636.