CAZyme Information: MGYG000000754_01313

Basic Information

• Species: Streptococcus sp900555155
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900555155
• CAZyme ID: MGYG000000754_01313
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		21771.63	7.3047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000754	1511164	MAG	Bangladesh	Asia

• Gene Location: Start: 7; End: 582 Strand: +

Full Sequence      

MLAVFLFAGYKAYHIHQDVKQVMTYQPMVREILSERDTPANEELVLAMIYTETKGKERDV
MQSSESASGATNTIKDDASSIRQGVQRLTDNLYLAQSKGVDVWTAVQAYNFGPAYIDFIA
QNGKENTLALAKRYSRETVAPILGNTTGKTYTYINPISIFHGAELYENGGNYYYSRQVRF
NLYIMKFFNFF

Enzyme Prediction     

No EC number prediction in MGYG000000754_01313.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	1.86e-82	19	182	1	165	Lysozyme-like.
cd16891	CwlT-like	2.17e-64	25	178	1	146	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	2.97e-06	2	189	103	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHZ47760.1	7.98e-132	1	191	10	200
BBA08600.1	8.24e-132	1	191	1	191
ANR75830.1	1.13e-131	1	191	10	200
ATF56771.1	1.61e-131	1	191	10	200
AQA08762.1	2.36e-131	1	191	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.11e-18	21	178	23	173	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	1.49e-16	21	178	25	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	1.31e-116	1	191	10	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	2.64e-116	1	191	10	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
P0DC90	1.01e-70	6	186	14	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	1.01e-70	6	186	14	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1
Q99ZN9	1.43e-70	6	186	14	194	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.909280	0.087146	0.002853	0.000226	0.000126	0.000385

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000754_01313.