CAZyme Information: MGYG000000748_00964

Basic Information

• Species: UBA10677 sp900762945
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp900762945
• CAZyme ID: MGYG000000748_00964
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	MGYG000000748_28|CGC1	36810.11	10.0293

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000748	1946382	MAG	Kazakhstan	Asia

• Gene Location: Start: 8176; End: 9210 Strand: +

Full Sequence      

MKKIILTGGGTAGHVTPNLALLPYLEPRFEIHYIGSVGGMEKRLLAPYKGVIYHEIPCVK
LIRSLTPKNLLIPFRLLKSVNAAKRLITEIQPSVIFSKGGFVALPVCLAAGKVPVILHES
DLTPGLANRLAARKCAEFLTSFDTCIARAKRVGAPLRREIYRGDKSRARLECGFSGLKPV
LLVTGGSLGAKALNEAVAAALPALTEKFDVVHLTGRGNLSGVKTAGYYQKEFAENMPDFF
ALADAVISRGGANTLFELAALGLPSLIVPLPKGNSRGDQIDNARYFEARGAVRVLLQENL
SPAALAAAITEVYDRKSELTAACKALGYVDGTATIARILARYGE

Enzyme Prediction     

No EC number prediction in MGYG000000748_00964.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	181	324	6.5e-41	0.9235668789808917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.22e-121	1	339	1	351	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	2.51e-100	3	338	1	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.90e-96	2	342	1	354	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK12446	PRK12446	5.90e-96	1	339	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
TIGR01133	murG	3.02e-84	2	339	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA52094.1	3.44e-99	1	339	1	349
QUC66253.1	4.72e-99	1	339	1	349
QRT48702.1	1.38e-98	1	335	1	345
QTE70149.1	3.80e-98	1	339	1	349
QTE74121.1	3.80e-98	1	339	1	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	8.37e-38	3	312	4	321	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.63e-36	2	341	7	352	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	6.37e-34	2	334	10	355	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z1B5	3.90e-88	1	313	1	323	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=murG PE=3 SV=1
Q893R7	1.77e-87	2	342	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
A9KK83	2.28e-87	1	324	1	334	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=murG PE=3 SV=1
A4IJS4	2.35e-87	2	339	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=murG PE=3 SV=1
A7GGX9	5.01e-86	1	317	1	327	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000748_00964.