CAZyme Information: MGYG000000728_00856

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212
• CAZyme ID: MGYG000000728_00856
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		34201.31	4.4269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000728	1947591	MAG	Kazakhstan	Asia

• Gene Location: Start: 1101; End: 1982 Strand: +

Full Sequence      

MRFLINERPVFQRLVLDQGYYRDGIYTAPTEEDLIKDIQISLDAGFNGARLHQKTFEPRF
LYHCDRMGYLVWDEYGNWGVDVSDFKIMANYIPEWLEEIERDFNHPSIIGWCPFNETWDY
RGRTQDNDILRDIYLITKAADPTRPCIDTSGVFHVMTDIFDIHEYEQNPEVFKAAFDGLR
TEGGLPERFLYKQTYKGEPVFISEYGGIKWAPGTEGGWGYGDAPASEQAFIERYRGLTEA
LLDNPKICGFCYTQLYDIEQEQNGLYYYDRSSKFAAEIFKKINSKKAAIEEEV

Enzyme Prediction     

No EC number prediction in MGYG000000728_00856.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.54e-15	2	170	292	451	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	3.56e-10	3	145	8	157	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	2.19e-06	30	145	369	484	beta-galactosidase.
PRK10340	ebgA	8.68e-05	3	144	327	470	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS26546.1	8.16e-141	1	292	295	588
SMF87854.1	1.10e-139	1	291	290	582
QLG42947.1	1.14e-138	1	291	287	579
AIQ16879.1	1.25e-138	1	291	290	582
QOS82722.1	1.67e-138	1	291	288	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	8.01e-29	1	270	303	565	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
6ED1_A	3.18e-11	24	206	329	514	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6B6L_A	7.78e-09	36	160	320	448	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	7.79e-09	36	160	320	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3DYO_A	4.71e-07	31	159	369	498	ChainA, Beta-galactosidase [Escherichia coli K-12],3DYO_B Chain B, Beta-galactosidase [Escherichia coli K-12],3DYO_C Chain C, Beta-galactosidase [Escherichia coli K-12],3DYO_D Chain D, Beta-galactosidase [Escherichia coli K-12],3DYP_A Chain A, Beta-galactosidase [Escherichia coli K-12],3DYP_B Chain B, Beta-galactosidase [Escherichia coli K-12],3DYP_C Chain C, Beta-galactosidase [Escherichia coli K-12],3DYP_D Chain D, Beta-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03WL0	8.15e-08	19	145	359	478	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
Q8D4H3	1.94e-07	5	145	341	480	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2
Q7MG04	1.94e-07	5	145	340	479	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q6LL68	2.58e-07	5	159	339	493	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
B4S2K9	3.45e-07	2	159	340	497	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000728_00856.