CAZyme Information: MGYG000000701_00393

Basic Information

• Species: Prevotella sp900552675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900552675
• CAZyme ID: MGYG000000701_00393
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		30560.78	4.6671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000701	3061545	MAG	Kazakhstan	Asia

• Gene Location: Start: 15303; End: 16103 Strand: +

Full Sequence      

MAKKVLFINQEIAPYVPETGLSEKGRDLPHKIQEAGYEIRTFMPKWGNINERRGQLHEVI
RLSGMNLIIDDTDHPLIIKVASIPQTRLQVYFIDNDDYFMKRQMALDENGDEYTDNGERA
IFFARGVLETVKKLRWEPDIIHCQGWMGAIVPLFVKQAYQDEPTFANTKIVTSLFDDELK
TCVGKDFKKSLAFKNVNDELLKDYKTDFDFFELQKLAIDYSDAIIQAGSEETEAVKYAAT
KNIPFLKEVGDDYAAAYSALYEDITK

Enzyme Prediction     

No EC number prediction in MGYG000000701_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	4	225	6e-42	0.4449152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	4.70e-47	5	225	1	214	Starch synthase catalytic domain.
PRK14098	PRK14098	1.45e-43	4	174	7	178	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	4.55e-30	4	174	1	164	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	7.66e-23	4	171	2	150	glycogen synthase GlgA.
COG0297	GlgA	2.66e-22	4	175	2	162	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48542.1	3.80e-136	1	264	1	265
BCS86507.1	2.19e-135	1	264	1	265
VEH15703.1	2.27e-135	1	264	1	265
QYR10714.1	1.82e-129	1	265	1	267
AGB28837.1	1.88e-129	3	264	4	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNF_A	9.48e-07	5	174	24	200	GranuleBound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_B Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1],6GNF_C Granule Bound Starch Synthase from Cyanobacterium sp. CLg1 bound to acarbose and ADP [Cyanobacterium sp. CLg1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	1.66e-39	4	174	7	178	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
B4S584	2.37e-39	4	224	7	224	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
Q3B6C3	8.61e-39	4	174	7	178	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B3QR00	4.40e-38	4	224	7	224	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1
B4SC83	8.61e-38	4	174	7	178	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000701_00393.