CAZyme Information: MGYG000000699_00454

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Bulleidia
• CAZyme ID: MGYG000000699_00454
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000000699_48|CGC1	38425.19	6.1368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000699	1671307	MAG	Kazakhstan	Asia

• Gene Location: Start: 4465; End: 5472 Strand: +

Full Sequence      

MKRKCNIIWMIHACKEYDMEPVITLLHFTCPKWLITKGGWEADTTPEDFAKYVQYVCEHL
KEEELHYIVTINEANMGLLIAGYIEKIRKNAGGAGLQIGMDMEAMALQQQKAEKENLEVF
GVKQAAVFTSPRSTHGDEIVCEAHMKAVKIIHEVLPGVKAGLSLSIRDLQAVSGGEKNVE
KDWQKDFLHYLPYMEQDDFFGVQTYTRALFDEKGEREPDSKAKLTQMGYENYPECVEHVL
KKVYKSFKKELLVTENGIATDNDEERCQYIETAVKGALKCKKEGIPVVGYMYWSMIDNYE
WQSGYSMHFGLMSLDRKTQKHTPKPSLYVLGKYAE

Enzyme Prediction     

No EC number prediction in MGYG000000699_00454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	10	333	1.1e-67	0.745920745920746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	5.49e-39	11	329	106	445	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	2.06e-33	10	328	103	442	Glycosyl hydrolase family 1.
PLN02998	PLN02998	5.55e-11	17	328	134	479	beta-glucosidase
PLN02814	PLN02814	3.00e-09	10	326	122	472	beta-glucosidase
PLN02849	PLN02849	6.45e-08	19	328	133	474	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK81646.1	1.45e-112	10	333	95	426
AXB29242.1	3.45e-110	10	335	95	432
CBL02685.1	4.88e-110	10	333	95	430
AEN97245.1	2.87e-109	10	333	94	432
AHF25575.1	5.10e-108	10	331	102	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4R27_A	1.09e-56	10	334	98	409	Crystalstructure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167],4R27_B Crystal structure of beta-glycosidase BGL167 [Microbacterium sp. Gsoil167]
6IER_A	3.41e-46	10	334	123	428	Apostructure of a beta-glucosidase 1317 [uncultured bacterium]
6Z1H_A	8.08e-33	10	328	109	439	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6KDC_A	1.07e-30	10	334	121	446	crystalstructure of Fpglu1 from fervidobacterium pennivoraus [Fervidobacterium pennivorans DSM 9078]
1VFF_A	3.96e-28	19	334	103	403	beta-glycosidasefrom Pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q08638	1.36e-23	10	328	104	433	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
B9K7M5	5.57e-22	10	328	102	431	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2
P0C946	4.23e-21	10	320	102	423	1,4-beta-D-glucan glucohydrolase (Fragment) OS=Thermotoga neapolitana OX=2337 GN=bglA PE=3 SV=1
P10482	7.01e-21	10	333	103	450	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P22505	7.77e-20	6	326	98	435	Beta-glucosidase B OS=Paenibacillus polymyxa OX=1406 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000699_00454.