CAZyme Information: MGYG000000696_00700

Basic Information

• Species: Parabacteroides sp900549585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900549585
• CAZyme ID: MGYG000000696_00700
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627		70841.87	7.233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000696	3184747	MAG	Kazakhstan	Asia

• Gene Location: Start: 65862; End: 67745 Strand: +

Full Sequence      

MCQGRFFKTAASVLLFACAFSSSAEAQIANNPAVKQVKISGYVGNRIDDCIEHRVKSQDV
DHLVEPFRHHEEKSRWQSEFWGKWIQGAIASYRYNKDSELYQIIKQAAESLMATQLPNGY
IGNYAPEHQLKEWDVWGRKYSSLGLIAWYDLSGEKKALEAACKVIDHLMTQVGSGKTSIV
ATGNYIGMPSSSILEPVMYLYNRTKEVRYLDFAKYIVAEWETPEGPQLISKAIADVPVAN
RFPHPKVWFSRENGQKAYEMMSCYEGLLELYKVTRNPLYLSVVEKTVGHIVREEINIAGS
GSAFECWYGGKERQTLPTYHTMETCVTFTWMQLCNRLLQITGNSLYADYMEKATYNALMA
SLKNDASQIAKYSPLEGCRHEGEEQCGMHINCCNANGPRAFAMIPQFAYQVEKETVHINF
YAPSELEWTLPNKKSVLLKQMTDYPATDKIEIEVEPAKEADFTVALRIPAWSKQTIVSVN
GKAEKETLPGAYLPITRKWKKGDRITIQLDLRARLVEQDGAQAIVRGPIVLARDSRFNDG
YIDETSVIVSKDGYVDLTPVKAPGFAWLAFTAPLVLGTDLEGNAAAKPVYFCDFASAGNT
WDKAQRYRVWLPKTLNVQHAPYVPYNR

Enzyme Prediction     

No EC number prediction in MGYG000000696_00700.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	72	531	6.3e-65	0.9064885496183206

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.28e-70	59	532	24	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.15e-65	25	547	5	515	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.08e-233	34	626	24	621
QOY86860.1	6.20e-49	83	530	97	547
AXC10260.1	5.47e-44	83	533	133	592
QHS51661.1	8.57e-44	83	534	123	582
SNY90695.1	7.38e-43	33	584	23	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	6.22e-38	83	538	74	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
6YQH_AAA	1.91e-27	323	532	337	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.72e-26	49	530	40	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5OPJ_A	1.84e-26	323	532	337	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QK0_A	1.24e-24	49	530	40	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.41e-15	83	540	80	574	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001091	0.636845	0.360912	0.000549	0.000322	0.000258

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000696_00700.