CAZyme Information: MGYG000000695_00420

Basic Information

• Species: Prevotella sp000436035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000436035
• CAZyme ID: MGYG000000695_00420
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36814.85	6.4903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000695	3484843	MAG	Kazakhstan	Asia

• Gene Location: Start: 20519; End: 21508 Strand: -

Full Sequence      

MKQLLLSFLMLLSATNLLAANKYDNPDTLVVSRDGTGEFRTIDEAIEVCRAFMDYTKVIY
VKKGIYKEKLIIPSWLTHITICGEDRDNTIITWDDHANILMPIGGLDSEAAVKGKPMGTF
RTYTLKVQGSYITLENITIENNAAKLGQAVALHTEGDHILVHNCRLLGNQDTVYTGVAGT
RIAFYDCYIEGTTDFIFGPSKAWFENCEIHSKANSYITAASTPAGQNYGYVFNNCKLTAD
EGVDKVYLGRPWRPFAATIFMNCEMGKHIVPAGWDNWRNPKNEETANYAEYNNHGAGAST
KNRVKWSKLLTKKEASKIDITTVFGEDCW

Enzyme Prediction     

No EC number prediction in MGYG000000695_00420.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	321	3.6e-101	0.9756944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.92e-79	30	317	3	288	Pectinesterase.
PLN02773	PLN02773	2.54e-73	29	315	7	287	pectinesterase
PLN02682	PLN02682	2.09e-70	19	329	61	366	pectinesterase family protein
COG4677	PemB	3.66e-66	26	324	80	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	3.43e-63	29	316	13	278	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66521.1	4.09e-196	1	329	1	329
BCS84477.1	7.51e-166	1	326	1	317
QVJ81978.1	9.96e-154	1	329	1	320
ADE82952.1	9.96e-154	1	329	1	320
QJR97878.1	1.00e-152	20	325	13	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	1.00e-40	29	311	9	288	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.63e-40	30	306	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.82e-39	29	326	11	289	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	3.58e-39	29	326	11	289	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	2.15e-29	32	326	12	336	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.83e-54	31	315	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	1.34e-52	29	314	82	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	1.19e-50	19	327	75	379	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GXA1	4.25e-50	30	315	259	542	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
P41510	1.05e-49	28	323	272	563	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.999059	0.000172	0.000162	0.000149	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000695_00420.