CAZyme Information: MGYG000000682_00979

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4334
• CAZyme ID: MGYG000000682_00979
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		41311.35	7.5

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000682	2426258	MAG	Kazakhstan	Asia

• Gene Location: Start: 20540; End: 21643 Strand: +

Full Sequence      

MKQFLFLFSLLLTSIVSVAQDKCLQLADSIVKYQSASGGWCKNQNWLIGADAKVMKVCHD
TGVGSTIDNGATMTEMRNLVKAIDRLDEMMKHGFGDVGVETMQAKRNVYNDSFVRGVEYL
LKMQYDNGGFPQFYPPKLHEDYSSQITFNDNAMVGALCMLRDVANGSAYFKNVTIPTGIR
TKCMTAYTKGLQCVLDCQIRVDSLGKVLQYGTDAWKHGRRTVWCQQHDKATLYPAKARAY
ELPSYCGFGETCGILMLLMDVDNPSDDIKSAVAGAVEWLEAHAMKNVAKETFVNSDGKKD
VRLVEKNGAPLLWARFYDLEEAVPFYCDRDGIPRRSLSDIGYERRNGYSWVGDQPAKIIE
RYKILNY

Enzyme Prediction     

No EC number prediction in MGYG000000682_00979.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	34	358	1e-92	0.9965277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	1.58e-112	34	359	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	3.93e-99	34	359	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd02892	SQCY_1	0.001	27	154	348	445	Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. This group contains bacterial SQCY which catalyzes the convertion of squalene to hopene or diplopterol and eukaryotic OSQCY which transforms the 2,3-epoxide of squalene to compounds such as, lanosterol in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFO38207.1	6.23e-105	26	363	52	356
SOE21140.1	6.62e-90	27	362	47	350
AEL26628.1	1.00e-81	19	362	52	364
QEC53563.1	8.21e-81	27	364	61	364
QUT25428.1	4.70e-80	21	363	49	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	3.08e-50	26	362	86	401	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.69e-41	27	367	37	331	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	2.46e-40	27	367	37	331	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000220	0.999205	0.000158	0.000129	0.000122	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000682_00979.