CAZyme Information: MGYG000000670_02111

Basic Information

• Species: Faecalibacillus sp900544435
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus sp900544435
• CAZyme ID: MGYG000000670_02111
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	MGYG000000670_36|CGC1	54717.42	6.9479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000670	2790604	MAG	Kazakhstan	Asia

• Gene Location: Start: 2204; End: 3589 Strand: +

Full Sequence      

MKYIFPKNFKWGSAVWAQGTEGAYNKDGKSPTVWDEYYRLHPERFFNKIGPSETLGWYDK
KFDVASLVESVGHNSFRTSIMWTRLIPDGKNINEKAVEFYKDMFQSFKEKNIELSVVLYW
FDMPLMYENEGGFSNRKIIEPFVYYCQKCFELFDDLVDIWYIYNEPFMDAIMKYENGLCY
PNEVDWNKLNKAIYNMVITHAKVVELYKKNNYSKKIGSVLNHAHVYSRSNHPEDQNARDI
IDLLKIKCFEDPLLGGYVNKDWMSFVKKYGANLDVDLKDNELIKNNTIKIVGLNIYGPLR
VKCPSYTINPHAPVTTTSFYEPYDMPGKRMNKYRGWEIYPQCLYDAVMDIKKRYNNPEMR
ITENGMGVQDEYRFRGKNGQIQDDYRIDFVKEHLLWVHKAIEDGANLVGYNMWSFIDLWS
PSNQFKNCYGFFEYDLKTEEIKRKKSADWFEKISKDNFIEI

Enzyme Prediction     

No EC number prediction in MGYG000000670_02111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	457	1.1e-107	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	9.20e-140	2	460	1	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.37e-98	1	457	1	451	Glycosyl hydrolase family 1.
PRK09852	PRK09852	1.01e-58	2	457	1	469	cryptic 6-phospho-beta-glucosidase; Provisional
PLN02814	PLN02814	4.41e-56	5	450	28	476	beta-glucosidase
PRK09589	celA	3.70e-49	5	457	4	472	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXG39009.1	2.61e-193	1	460	1	460
QNU37637.1	6.47e-145	1	457	17	474
QXJ37247.1	3.07e-144	1	457	22	479
QCX33789.1	7.05e-143	1	457	3	460
ASB88547.1	2.18e-141	2	457	12	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	3.88e-97	5	457	3	459	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	1.12e-96	5	457	4	460	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	1.11e-92	5	457	20	475	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	2.20e-92	5	457	20	475	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	1.34e-85	5	461	11	452	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.07e-130	2	454	6	460	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	2.07e-73	2	457	3	446	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
C7N8L9	3.05e-70	1	454	1	462	6-phospho-beta-galactosidase OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) OX=523794 GN=lacG PE=1 SV=1
Q1J4Q7	5.07e-68	1	460	1	468	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) OX=370554 GN=lacG PE=3 SV=2
Q8NZE1	9.97e-68	1	460	1	468	6-phospho-beta-galactosidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=lacG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000670_02111.