CAZyme Information: MGYG000000666_01692

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_01692
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		71738.14	9.859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 5542; End: 7404 Strand: +

Full Sequence      

MKRTLIAATLLALSAALFPAAAESPDPYGICYHITFMDDGIQMRRDLRLLKRIGISMIRS
DLNWPWIPKGKDGKYNYAKIDKCVRILKRNKMKLLPILNQAPPEAQPYHEHLDQWADFVR
QTVERYRKDMPYWEVINEHNFTNQGHWGSRELPVHTKHYTQLLKKTYETIKEIDPNLQVL
YGGTSHIPLEYIESTFRYGAGEYFDIMNVHPYAWADEPETLTERLRNLNTLMKKFGLENK
PVWVTEIGWSTAPQKRPRIYRQILPIAFRKIGIDPKKVPIVFLDKVHSRIMDFKSSFPEF
KEWISLPSDRLKNLDPRKYPVLLPVVEEYYDPYHAKELIRYVKRGGTIILPQGVPFNYPR
KRLRNDLAEIPYPKLDLKKELGIAMEFPWTHRHPETKQIEIPGIPEKELHHFSNIRFLSG
KEMKGEDRFLPLAYGVKGDFRKPFAGIYRYSNGRKGNVIVIAQRADVVQAETTEAMQAEI
LPRAHLLMFAEGVQKVFWYSFLSGDPESNNVEANFGIVSRERVPKPAYRAYGTLSKMFPK
GSTKPVVRIRPDGVYTAKWQRPDGKQVLAVWLPDKTAKCRLPIGEKILETINHLGDPVSV
NPADLTVSPGILYFVCEGGN

Enzyme Prediction     

No EC number prediction in MGYG000000666_01692.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	71	256	2.6e-28	0.5011600928074246

CDD Domains     

MGYG000000666_01692 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44885.1	7.57e-136	2	615	4	609
QDU57372.1	7.51e-85	19	614	19	622
AVM44901.1	3.16e-55	1	571	1	583
AHF90941.1	5.72e-33	20	612	226	840
ADE82856.1	2.29e-32	17	615	27	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	5.72e-10	23	251	101	345	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
1HIZ_A	2.93e-06	41	138	39	159	XylanaseT6 (Xt6) from Bacillus Stearothermophilus [Geobacillus stearothermophilus],1R85_A Crystal structure of the extracellular xylanase from Geobacillus stearothermophilus T-6 (XT6): The WT enzyme (monoclinic form) at 1.45A resolution [Geobacillus stearothermophilus],1R87_A Crystal structure of the extracellular xylanase from Geobacillus stearothermophilus T-6 (XT6, monoclinic form): The complex of the WT enzyme with xylopentaose at 1.67A resolution [Geobacillus stearothermophilus]
3MMD_A	2.93e-06	41	138	39	159	ChainA, Endo-1,4-beta-xylanase [Geobacillus stearothermophilus]
4PUD_A	6.65e-06	41	138	31	151	ExtracellulrXylanase from Geobacillus stearothermophilus: E159Q mutant, with xylopentaose in active site [Geobacillus stearothermophilus],4PUE_A Extracellulr Xylanase from Geobacillus stearothermophilus: E159Q mutant, with xylotetraose in active site [Geobacillus stearothermophilus]
4PRW_A	6.79e-06	41	138	39	159	XylanaseT6 (XT6) from Geobacillus Stearothermophilus in complex with xylohexaose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999076	0.000177	0.000173	0.000157	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_01692.