CAZyme Information: MGYG000000666_00315

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_00315
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		88347.96	5.7637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 2711; End: 5038 Strand: +

Full Sequence      

MRTHIISTFHYDVIYLKEYRSYLEESIRILDRALELLEREADYKFTVEQILPVREYFRRH
PERRMQMRRLAQSGRLCFAPGMLMPDMNLLGGGETLFRQIESGRSWLRDHLGVTPDACWI
ADCWGHHAQLPQMLSQSGYRSYFFWRGMDPEFRQNNFRWKGLDGTELLTHWLPRGYSGIF
FPEKQPGIANAEEQRFAEASAEEIARLTDQERRFGASEQILICNGGDFRMPQESAPSALR
AIREREPSSRIEFSTPTEYAAATAEEDLPVYAGEFNALFQGTFSTNIRIKQGIRRHTARL
LAEEMFLAIQNRSHESLRPQWETVLKLCFHDTVCGTICDAALKSVQADLQALDLLTSSGD
AVFNPTAHPRRETLELPDSTRLLVDLKPFETRPLREFPECPPLLPQNPEEGMKFETAYYT
VSIHRNGFLSSLRTARGTEWINSASPAAFGSLVMQNDNGDSWQLYEGPIDGGSEAAAYAH
NDPDPLERPVPANDIVNRHNFYPTIREVRLFRSQESLRVVQKGELGFWRNRVSFVSTMEC
DANSPLIRWKIRIRTEGRHYRLRAAFPTLLRNGTVTHEIPFGLQVRGHSEFPAETFCDYS
GERGGITLFNRGLPGNNVDADGVMLLSLFRSAAMEYKCDSALSFQEGEEMEAEFALMVRE
ESSMDAVIAEAERYAAPLIPVPSTSPAVDLTNLRLPDNVRVSTLRSDGKSLFLRLYEGVG
KATRISLPLPESFHFWRNANALGEGVDKPEILSGPLEWNLRPFEIKNLLLYGEHI

Enzyme Prediction     

No EC number prediction in MGYG000000666_00315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	3	267	9.8e-56	0.9368029739776952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10786	GH38N_AMII_like	2.00e-68	4	236	3	238	N-terminal catalytic domain of class II alpha-mannosidases and similar proteins; glycoside hydrolase family 38 (GH38). Alpha-mannosidases (EC 3.2.1.24) are extensively found in eukaryotes and play important roles in the processing of newly formed N-glycans and in degradation of mature glycoproteins. A deficiency of this enzyme causes the lysosomal storage disease alpha-mannosidosis. Many bacterial and archaeal species also possess putative alpha-mannosidases, but their activity and specificity is largely unknown. Based on different functional characteristics and sequence homology, alpha-mannosidases have been organized into two classes (class I, belonging to glycoside hydrolase family 47, and class II, belonging to glycoside hydrolase family 38). Members of this family corresponds to class II alpha-mannosidases (alphaMII), which contain intermediate Golgi alpha-mannosidases II, acidic lysosomal alpha-mannosidases, animal sperm and epididymal alpha -mannosidases, neutral ER/cytosolic alpha-mannosidases, and some putative prokaryotic alpha-mannosidases. AlphaMII possess a-1,3, a-1,6, and a-1,2 hydrolytic activity, and catalyzes the degradation of N-linked oligosaccharides. The N-terminal catalytic domain of alphaMII adopts a structure consisting of parallel 7-stranded beta/alpha barrel. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.
pfam01074	Glyco_hydro_38	9.76e-40	4	275	3	267	Glycosyl hydrolases family 38 N-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.
cd10814	GH38N_AMII_SpGH38_like	1.99e-35	4	274	3	266	N-terminal catalytic domain of SPGH38, a putative alpha-mannosidase of Streptococcus pyogenes, and its prokaryotic homologs; glycoside hydrolase family 38 (GH38). The subfamily is represented by SpGH38 of Streptococcus pyogenes, which has been assigned as a putative alpha-mannosidase, and is encoded by ORF spy1604. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. A divalent metal ion, such as a zinc ion, is required for its activity. SpGH38 is inhibited by swainsonine. The absence of any secretion signal peptide suggests that SpGH38 may be intracellular.
cd10789	GH38N_AMII_ER_cytosolic	1.47e-28	4	259	3	245	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). The subfamily is represented by Saccharomyces cerevisiae vacuolar alpha-mannosidase Ams1, rat ER/cytosolic alpha-mannosidase Man2C1, and similar proteins. Members in this family share high sequence similarity. None of them have any classical signal sequence or membrane spanning domains, which are typical of sorting or targeting signals. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 utilizes both the cytoplasm to vacuole targeting (Cvt, nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Man2C1is involved in oligosaccharide catabolism in both the ER and cytosol. It can catalyze the cobalt-dependent cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl-enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.
cd10790	GH38N_AMII_1	4.77e-27	2	285	1	271	N-terminal catalytic domain of putative prokaryotic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). This mainly bacterial subfamily corresponds to a group of putative class II alpha-mannosidases, including various proteins assigned as alpha-mannosidases, Streptococcus pyogenes (SpGH38) encoded by ORF spy1604. Escherichia coli MngB encoded by the mngB/ybgG gene, and Thermotoga maritime TMM, and similar proteins. SpGH38 targets alpha-1,3 mannosidic linkages. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. MngB exhibits alpha-mannosidase activity that catalyzes the conversion of 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. TMM is a homodimeric enzyme that hydrolyzes p-nitrophenyl-alpha-D-mannopyranoside, alpha -1,2-mannobiose, alpha -1,3-mannobiose, alpha -1,4-mannobiose, and alpha -1,6-mannobiose. The GH38 family contains retaining glycosyl hydrolases that employ a two-step mechanism involving the formation of a covalent glycosyl enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst. Divalent metal ions, such as zinc or cobalt ions, are suggested to be required for the catalytic activities of typical class II alpha-mannosidases. However, TMM requires the cobalt or cadmium for its activity. The cadmium ion dependency is unique to TMM. Moreover, TMM is inhibited by swainsonine but not 1-deoxymannojirimycin, which is in agreement with the features of cytosolic alpha-mannosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF89381.1	5.00e-138	1	774	1	804
QEH33435.1	3.70e-62	5	770	39	860
APW59384.1	1.40e-55	5	775	39	867
AJC72711.1	3.05e-46	1	768	1	762
QNT76422.1	2.10e-42	10	765	11	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JM0_A	7.71e-14	6	343	307	652	Structureof the S. cerevisiae alpha-mannosidase 1 [Saccharomyces cerevisiae S288C]
5KBP_A	2.11e-13	2	369	8	405	Thecrystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],5KBP_B The crystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
3LVT_A	5.64e-12	2	369	8	405	TheCrystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A [Enterococcus faecalis V583]
1HWW_A	6.19e-10	1	173	51	235	GOLGIALPHA-MANNOSIDASE II IN COMPLEX WITH SWAINSONINE [Drosophila melanogaster],1HXK_A Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin [Drosophila melanogaster]
6RPC_A	6.22e-10	1	173	69	253	ChainA, Alpha-mannosidase 2 [Drosophila melanogaster],6RQZ_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RRH_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RRJ_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RRN_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RRU_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RRW_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RRX_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RRY_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster],6RS0_A Chain A, Alpha-mannosidase 2 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9NTJ4	1.29e-23	10	770	260	1033	Alpha-mannosidase 2C1 OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=1
P21139	8.12e-22	10	770	259	1033	Alpha-mannosidase 2C1 OS=Rattus norvegicus OX=10116 GN=Man2c1 PE=1 SV=1
Q91W89	5.59e-21	4	770	253	1032	Alpha-mannosidase 2C1 OS=Mus musculus OX=10090 GN=Man2c1 PE=1 SV=1
Q9KER1	1.76e-16	4	353	6	371	Putative mannosylglycerate hydrolase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=mngB PE=3 SV=2
Q54K67	1.07e-13	10	336	264	585	Alpha-mannosidase G OS=Dictyostelium discoideum OX=44689 GN=manG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_00315.