CAZyme Information: MGYG000000652_01292

Basic Information

• Species: Bacteroides togonis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides togonis
• CAZyme ID: MGYG000000652_01292
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
946	MGYG000000652_10|CGC1	105055.62	4.9859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000652	3410500	MAG	Germany	Europe

• Gene Location: Start: 7243; End: 10083 Strand: +

Full Sequence      

MKKLIVTTLLAGGCLSILYAQTTKTTPKTYKPTKTEMYRKGWIDFNKNGVKDVYEDPNAP
IDARIEDLLGQMTLDEKTCQMVTLYGYQRVLKDDLPTPEWKQALWKDGIGAIDEHLNGFR
QWGLPPSDNENVWPASRHAWALNEVQRFFVEETRLGIPVDFTNEGIRGVESYRATNFPTQ
LGIGHTWNRSLVRRIGEITGREARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAE
LGIEMVHGLQKDHQVAATAKHFVAYSNNKGAREGMARVDPQMSPREVEMIHVYPFKRVIQ
ETGLLGVMSSYNDYDGIPIQGSFYWLTTRLRGEMGFKGYVVSDSDAVEYLYTKHGTAKDM
KEAVRQSVEAGLNVRCTFRSPESFVEPLRELVKEGGLSEELINDRVRDILRVKFLVGLFD
APYQTDLAGADEEVENPTNEDVALQASRESIVLLKNDKQTLPLDIDRIKTIAVCGPNADE
EGYALTHYGPLAVDVTTVLEGIQAKVEGKAEVLYTRGCDLVDAHWPESELIEYPLTDDEQ
AEIDRAVANARRADVAVVVLGGGQRTCGENKSRSSLDLPGRQLKLLQAVQATGKPVVLVL
INGRPLSINWADKFVPAIVEAWYPGSKGGTAVADVLFGDYNPGGKLTVTFPKSVGQIPFN
FPCKPSSQVDGGKNPGPDGNMSRVNGALYPFGYGLSYTTFEYSDLKISPAVITPNETVTV
TLNVTNTGSRAGDEVVQLYTRDVVSSVTTYEKNLAGFERVHLQPGETKQVTFHLDRKQLE
LLNADMKWVVEPGEFVVMAAASSEDIRQTAVLHVEDYATRNARLEAEKPENPVTASTNLE
SALHVLDGDNQTFWQGNKGDYLTFALKGNPKVDEVTVTFIRDNKLPANFEIQLSGGGGQF
LTVYSGTVSEYNKPHTYTFRGTTASDLRILLNDDRVGIAEVNLKLP

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	151	376	6.9e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	62	808	35	759	beta-glucosidase BglX.
PLN03080	PLN03080	1.25e-99	60	798	48	767	Probable beta-xylosidase; Provisional
COG1472	BglX	1.32e-74	138	489	41	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.01e-70	451	697	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.51e-61	73	412	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT34231.1	0.0	1	941	1	940
QUT62569.1	0.0	1	941	1	940
QQA31118.1	0.0	1	941	1	940
BBK89234.1	0.0	1	941	1	940
QUT68890.1	0.0	1	941	1	940

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.06e-128	51	815	4	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXL_A	2.54e-128	142	807	69	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
7EAP_A	7.98e-128	51	815	4	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXN_A	1.37e-127	142	807	69	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	7.93e-121	142	809	68	746	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	6.86e-143	154	804	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	1.33e-130	62	808	35	759	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.87e-130	62	808	35	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	7.25e-119	54	810	29	751	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.46e-96	57	806	30	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001235	0.572273	0.424991	0.000606	0.000506	0.000371

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000652_01292.