CAZyme Information: MGYG000000640_01234

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677
• CAZyme ID: MGYG000000640_01234
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000000640_17|CGC1	42826.62	5.9652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000640	2090947	MAG	Madagascar	Africa

• Gene Location: Start: 25016; End: 26110 Strand: -

Full Sequence      

MTNKLIKGMGIGGWLTNYKRFNVLPDEWRLALTEGDFEHFDSFITRRDVDYIASLGFDHI
RLGFDQIVIEEAPFVYRERTIRKLDDFVEWCEAAGVRPILNLHKAVGNYCDIPEKIQLLD
DETLQDRFAALWVELERRYAGKPSVAFELLNEVRDVDADKWNALCARTLAAIRRLNAERL
VIVGGTQWNSARALDKMKTYDDPNVLYTFHMYEPFEFTHQRGVLQAPTLYYNRALSYPCA
DVERYRDYHRVVCKNPNTYRDFSVIDINYLREAMAGAKKFRDENPDKVLWLGEFGTIRHA
DPESRENYMRDVISLCREWGIPYCVWNYLSTPNDGNRFSLVDDDTRKVLTPRLERIIKGE
ERYR

Enzyme Prediction     

No EC number prediction in MGYG000000640_01234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	35	329	2e-77	0.9456869009584664

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.35e-29	41	328	22	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.92e-17	39	228	69	284	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45789.1	2.50e-154	8	360	10	363
AOA60286.1	3.85e-63	8	357	10	340
BAJ62400.1	9.85e-61	8	328	10	320
CUH93289.1	2.79e-59	8	328	10	317
BAA00793.1	4.31e-58	8	328	7	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	8.70e-59	8	328	7	315	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	2.43e-58	8	328	7	315	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
3AMC_A	5.05e-22	50	330	40	290	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AOF_A	6.92e-22	50	330	40	290	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]
3AMG_A	3.35e-21	50	330	40	290	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23340	8.61e-59	8	328	7	315	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	8.61e-59	8	328	7	315	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P0C2S3	6.70e-58	8	328	7	315	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	3.10e-32	5	220	7	210	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P25472	3.92e-21	5	344	31	308	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000640_01234.