CAZyme Information: MGYG000000637_00186

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495
• CAZyme ID: MGYG000000637_00186
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
706	MGYG000000637_12|CGC1	80517.75	5.2659

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000637	1277650	MAG	Madagascar	Africa

• Gene Location: Start: 4956; End: 7076 Strand: +

Full Sequence      

MDALLKELADRLGIATFFSDAGLRRQEYNVDENTIRFFVRAMGYTCDTKEETLASLRRID
GVRWAQCVRDIYVRQVGDIVIDVVSKDLSDIKIKAKDCDGNTFDVLYAYMQNSTNNGELY
KEDLRLTTDLTPGYYELELEVAGKKHKTTLAVAPQTCKKLEDEQKLWGFALQLYSLKSRR
NWGIGDLTDLRNFVKLCGQSGADIIGLNPLNTLSHDYPENASPYLSISRQFLNPIYIDVE
VVPEFMPEDKKAIEPLLEELRASELIQYGKVYPLKVRMLEKCFDRFKVDKKSDRRKAYET
FCKCQGEALDNLAAFQAIYEVETQKVWGGWMASPEEYKNPNAAGVKAFVKEHKDRVEFFK
FMQFEADRQFGLAAAEVKANGLKIGFYRDLAVGVGRDSAEYWSNPELFMRDAGTGAPPDA
FFPNGQKWGLGTFLPQVLQKQKYAPFIRMLRANMRYAGALRMDHVMSLLRLYVIPDASEK
GTYIYYNFADMLNIVALESYLNDCVIVGESIGNVPDGFLDKLKEKNIYALSILWAERWNA
GWGDFKQPADYPADAFTSVATHDIAPLKMWWFGYDIELNASLGLIGSAQDKADAYHKREA
DRGKLLEALDRAGVWPDDRPRSGNYIYGEAYPEGIEEAVERFMSKTTAPVFLAQLEDMLH
VIEMQNLPGTDHDKHPNWRRRIPVELENLSADSAYVRCVAAIRKER

Enzyme Prediction     

No EC number prediction in MGYG000000637_00186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	171	699	1.4e-134	0.979757085020243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14507	PRK14507	0.0	1	706	4	721	malto-oligosyltrehalose synthase.
PRK11052	malQ	7.13e-174	1	706	2	689	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	5.91e-147	171	684	1	459	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	2.32e-138	158	706	5	516	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14510	PRK14510	1.10e-128	165	706	723	1218	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWU95656.1	1.61e-145	5	700	4	721
QKS54043.1	1.44e-143	5	702	4	724
CBS88424.1	1.09e-142	5	700	4	721
BAI73574.1	5.28e-142	5	695	4	723
AWB07218.1	5.95e-139	5	700	4	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	1.13e-113	113	692	81	673	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	2.94e-109	113	692	81	673	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	1.83e-72	5	705	7	706	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
1TZ7_A	2.59e-22	165	682	22	483	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
1FP8_A	2.45e-20	169	475	7	305	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	4.16e-113	113	706	81	687	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	8.17e-105	133	694	113	685	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P9WK22	2.39e-84	5	703	8	714	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P65337	2.39e-84	5	703	8	714	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK23	2.39e-84	5	703	8	714	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000637_00186.