CAZyme Information: MGYG000000580_01792

Basic Information

• Species: Streptococcus vestibularis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus vestibularis
• CAZyme ID: MGYG000000580_01792
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193	MGYG000000580_17|CGC1	21814.02	9.7864

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000580	1956603	MAG	Madagascar	Africa

• Gene Location: Start: 11320; End: 11901 Strand: +

Full Sequence      

MRRRFKLKAFITLVVVFALGVLLPLILHASTDDNARSVKVAYTRQEFIETLAPIAQKMSK
NYGVPASILLSQAAYESNYGSSLLSVKYHNIYSLPAQPGQERIRLKDSIYSKGKWQYQKV
DFAVFKDWSSSMMTYLEELRQGTWGGSTYKEVAGTTSYKVAAEKLQAAGFSSDPDYAKHL
ISIIETYHLSKYD

Enzyme Prediction     

No EC number prediction in MGYG000000580_01792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	189	4.1e-26	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.96e-43	1	193	1	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	7.92e-22	38	193	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	1.19e-16	29	193	303	472	amidase domain-containing protein.
NF038016	sporang_Gsm	1.26e-14	43	193	159	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	2.61e-14	52	189	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY20374.1	3.91e-131	1	193	1	193
AMB81973.1	3.91e-131	1	193	1	193
CCB94493.1	3.91e-131	1	193	1	193
QKH70716.1	3.91e-131	1	193	1	193
ARI58045.1	3.91e-131	1	193	1	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.85e-14	27	193	12	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	9.27e-10	45	184	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	1.07e-09	45	184	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	1.36e-08	30	193	44	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.35e-08	45	185	4	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	8.91e-20	4	193	3	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	4.19e-13	45	193	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	3.57e-12	45	193	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	4.84e-12	47	193	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	1.38e-11	24	193	40	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.841854	0.151953	0.002137	0.000546	0.000426	0.003099

TMHMM  Annotations     

start	end
7	29