CAZyme Information: MGYG000000575_00459

Basic Information

• Species: UBA11452 sp003526375
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA11452; UBA11452 sp003526375
• CAZyme ID: MGYG000000575_00459
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000000575_10|CGC1	43659.4	9.4325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000575	4988607	MAG	Madagascar	Africa

• Gene Location: Start: 33476; End: 34657 Strand: -

Full Sequence      

MMEHSKAAPLIWIIAGESSGDLYGARLAQDIRKTRPQARIAGMGGVKMKNAGVDILVDSS
ELGVIGLIEVLGSIFKFIRIMLYLVREAKKQRPDAVVLIDYPGFNIRFAKRLKKAGIPVV
WYISPQVWVWRKSNIPKLAYYCTKMMVIFPFEVDVYKGSGLDVEFVGHPLVEIVQERRDP
ALARDPNRLLLLPGSRRSETKRLLFPMLETVALLKQRHPKLKFTIATPREKVYDDVKDDI
SEFIMKHPDSVLPEIDVVCGKTAECLQTCTAGLAASGTVTVECAIAGLPLVVAYRLNPIT
FLCARIIIRKLFRNAFTMPNIILNRRVFEEFLQFQVVPQDLADAVDRILPGGERRAQADA
DMEEMVHEISGGVKGAGMNAALAVLGVADSSKG

Enzyme Prediction     

No EC number prediction in MGYG000000575_00459.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	11	368	4.1e-108	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.41e-124	11	393	4	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.04e-114	8	385	1	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.92e-92	11	355	1	345	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.60e-80	9	385	6	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.11e-51	56	344	42	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	5.76e-142	11	383	8	381
AVM45461.1	2.62e-127	11	389	14	393
QEM70104.1	1.22e-71	13	385	2	368
QXM11626.1	3.24e-71	13	372	2	357
QXE93134.1	3.24e-71	13	372	2	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.54e-49	11	353	9	349	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.54e-49	11	353	9	349	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	2.60e-67	11	391	9	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	1.12e-65	10	385	5	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
A9KC41	2.58e-65	11	349	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J161	2.58e-65	11	349	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	5.12e-65	11	349	6	337	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000575_00459.