CAZyme Information: MGYG000000572_00101

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag1
• CAZyme ID: MGYG000000572_00101
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		32076.03	9.8835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000572	1867050	MAG	Madagascar	Africa

• Gene Location: Start: 38945; End: 39823 Strand: +

Full Sequence      

MRIVNNYFMNSCMPPIRMNPFMGGCCNSFNPMFQFGMMNSVFSMPQMFSFPNYSMPMFSP
MSMMANYTMPVLPTSGNIFSMANSAMAMPAFNPIMNFSMPAILNEFNLLNQTLQSFGNLT
ARKSKPNKAENSQSSKKSQKSSGKYDKKATELYTGSAEDLNKYLKGKGVLAGQGQAFLDA
QKKYGISASVLAGICLHESGNGKSKLARNNNNIGGIRIAGSTKFRTFNSVAECIDYMGGL
IKRNYVDKGLVTLSQINAKYCPPSDPTDTKGTNFIWAKCVDKHTDSIENALA

Enzyme Prediction     

No EC number prediction in MGYG000000572_00101.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	174	247	2.8e-16	0.6875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	4.03e-14	174	245	1	90	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG4193	LytD	1.85e-11	156	247	82	189	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
smart00047	LYZ2	5.70e-09	162	216	1	58	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	1.96e-07	175	252	44	149	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	8.43e-04	175	221	161	215	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38407.1	6.36e-118	5	290	8	288
AIM14958.1	8.92e-21	156	283	86	209
ALC92961.1	5.81e-19	156	287	97	224
APM83051.1	7.07e-19	160	280	64	184
ANZ32316.1	7.07e-19	160	280	64	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PI7_A	4.77e-08	150	285	60	209	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PI9_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PIA_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
5WQW_A	1.21e-07	160	208	76	124	X-raystructure of catalytic domain of autolysin from Clostridium perfringens [Clostridium perfringens str. 13]
4PI8_A	2.90e-07	150	285	60	209	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
6FXO_A	4.79e-06	156	208	74	126	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]
4Q2W_A	6.04e-06	147	266	141	269	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33635	4.75e-07	156	277	1165	1308	Bifunctional autolysin OS=Staphylococcus epidermidis OX=1282 GN=atl PE=1 SV=1
Q5HQB9	4.75e-07	156	277	1165	1308	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=atl PE=3 SV=1
Q8CPQ1	4.75e-07	156	277	1165	1308	Bifunctional autolysin OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=atl PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000572_00101.