CAZyme Information: MGYG000000559_02435

Basic Information

• Species: Paraprevotella sp900546665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900546665
• CAZyme ID: MGYG000000559_02435
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
523		58773.21	7.5765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000559	3371833	MAG	China	Asia

• Gene Location: Start: 611; End: 2182 Strand: +

Full Sequence      

MKPFSRIACGVLFCTAITNLQAQAVHFEIDASLPQQTIDGFGASDAWSMQFVGLWPDSVC
QKTADWLFSTENDKNGQPKGIGLSIWRFNVGAGSAEQGKDSQIGSIWTRTECFLTPDGQY
DWSKQKGQCHFLKLAKDRGVEQFLAFFNSPPVYFTQNGLATNTGRDGTYNLKPECEDDFA
RFAAEVITGMEKHHGIKFSYLCPVNEPDGHWNWIGPKQEGSPATNREIASIARAMSKEFV
RRGIDTKILVNESSDYRCMFSTHMTDWQRGYEIQSFFCPDSTDTYLGDTPNVPRMMAGHS
YWTNTPLSALRNIRKQLKDSLDKYQVKFWQTETCIMGNDEEIGGGGGYDRTMKTALYVGR
IIHHDLVYAGASSWQWWRAIGGDYKDGLLREYSSRDAKRGYVVDSKLLWVMGNYSRFVRP
GAVRMAVHATDAKGLTVTEGDTDQKGLMCTAFRNTDGRWAFVVLNYADEDKTITFEVKNE
KTGRWTPYITAEGEGVNLKPGKSIKNGRKTTIPARSAVTFVSL

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	26	521	7.3e-189	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	2.97e-136	24	389	1	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	2.90e-14	29	521	38	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	4.59e-06	421	520	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT59995.1	6.74e-276	12	522	10	520
QQY41954.1	6.74e-276	12	522	10	520
ALK83243.1	5.51e-275	12	522	10	520
QQY38682.1	3.18e-274	12	522	10	520
AND18694.1	3.18e-274	12	522	10	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	3.00e-92	27	521	8	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
1NOF_A	2.01e-15	149	522	84	382	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]
6IUJ_A	9.07e-12	4	522	3	471	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.84e-11	16	522	81	542	Crystalstructure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7O0E_A	6.17e-11	29	521	7	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	5.01e-11	12	521	8	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
Q6YK37	1.62e-08	133	521	103	420	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.999048	0.000212	0.000163	0.000140	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000559_02435.