CAZyme Information: MGYG000000555_01164

Basic Information

• Species: Cellulosilyticum sp900556665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Cellulosilyticum; Cellulosilyticum sp900556665
• CAZyme ID: MGYG000000555_01164
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000000555_108|CGC1	39045.23	5.815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000555	2866181	MAG	China	Asia

• Gene Location: Start: 4406; End: 5410 Strand: +

Full Sequence      

MKQVEFTLSNKNALPVCKRLMAYFKSVYGKGIISGQHTNAAKGNQLEEIFEISGKYPAIR
SFDLLSYTKGSNTKKLPQKQENTNSIEIDCHKEVEGNRGSVEEAIKWWEERGGIVTLCWH
WFAPIIGYDKTFYAHKTDFDIEKALVSGSTENKLMMEDIQQIAKVLMRFQERNIPILWRP
LHEANGNWFWWSRKGEGAYKQLYHLLYDELTNHYGLNNLIWVWNAPDPNYYVGDDYCDIG
SSDVYGPAYDYGSNQREYKVVEESMGGTKPVALAESFIIPHPEQLIKDEVPWLYFTIWNW
EQQEMILNNMTKEHIREVYNHPYVITLENLPNFK

Enzyme Prediction     

No EC number prediction in MGYG000000555_01164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	9	328	5.7e-97	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.25e-52	10	326	2	308	Glycosyl hydrolase family 26.
COG4124	ManB2	1.78e-17	173	275	179	294	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZT91229.1	1.37e-108	6	334	134	451
ADQ46006.1	1.56e-107	6	334	134	451
ABP66283.1	3.12e-107	6	334	134	451
QAA34445.1	6.24e-107	5	334	135	452
ADL42284.1	5.01e-106	6	334	134	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	8.90e-58	8	334	145	451	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.04e-56	10	299	8	280	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
6HF2_A	5.16e-45	8	334	45	360	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	5.42e-42	10	330	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	1.24e-41	101	333	117	355	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	4.84e-64	3	334	169	480	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	1.07e-52	8	334	146	461	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	1.19e-51	7	333	156	463	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55298	1.87e-49	7	333	155	462	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	3.74e-49	7	333	157	464	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000096	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000555_01164.