CAZyme Information: MGYG000000553_00105

Basic Information

• Species: Prevotella sp900548535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900548535
• CAZyme ID: MGYG000000553_00105
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		51657.21	9.2139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000553	2921999	MAG	China	Asia

• Gene Location: Start: 137921; End: 139237 Strand: -

Full Sequence      

MFNLVETLNHFLDWLSTLSFSSIVNTYWFLFFLEMPRYYILEYIVICYRMMNKNRRDKEK
EIARFYLYRENPLITILVPGKNEGKHIFKMVNSLAEQTYRNYEIIVVDDGSDDDTKLICT
DLYRAGYITHYLRLETRGGKAAASNYGAHMAKGKYIVSLDADSSLDRDALEKILLPFYMD
GMVKGVGGCVKVRNYKDTICSSLQAFEYLKRIQVGRIVTSELGIYHIISGAFGAFDHEIL
KEVGYWDIGPGLDGDLTQKIRKAGYKVKFAEDAICMTNVPTKWYKLYHQRIRWSRSLVRF
RLRKHIDILLPTKNWSILNWISNMESVMYDCFLNFLWLWYIVKLAITFNTHIVEVLALGY
FIRVCFSQFAFVLVMLVSERRKEDLFLYRFMPLMSPYTGYFLRLARLSAHLQELFFHRSY
KDAWNPEKTSRYAQLEGM

Enzyme Prediction     

No EC number prediction in MGYG000000553_00105.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	75	244	2.2e-31	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	8.19e-51	76	247	1	173	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.95e-41	27	431	14	435	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.49e-38	70	390	52	376	N-glycosyltransferase; Provisional
PRK14583	hmsR	2.48e-30	65	383	52	389	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
pfam13641	Glyco_tranf_2_3	5.22e-30	72	296	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65453.1	3.83e-295	1	438	1	438
BCS85412.1	8.35e-223	1	436	1	437
APD07883.1	7.78e-145	6	438	3	435
AZJ36032.1	7.91e-141	24	438	26	440
CAG5084162.1	1.19e-137	4	438	1	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.91e-14	73	173	6	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
2Z86_A	1.04e-11	58	180	361	482	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.04e-11	58	180	360	481	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
3BCV_A	1.27e-09	72	168	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XAR5	1.40e-28	48	296	51	299	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
P75905	1.92e-28	69	296	72	299	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q5HKQ0	9.40e-26	74	296	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	1.75e-25	58	296	29	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q6GDD8	5.22e-24	74	344	49	309	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999046	0.000931	0.000018	0.000001	0.000001	0.000012

TMHMM  Annotations     

start	end
26	48
333	352
356	378
385	407