CAZyme Information: MGYG000000541_00623

Basic Information

• Species: Bruticola sp004554425
• Lineage: Bacteria; Eremiobacterota; Xenobia; Xenobiales; Xenobiaceae; Bruticola; Bruticola sp004554425
• CAZyme ID: MGYG000000541_00623
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277		30207.29	5.1912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000541	2312271	MAG	Fiji	Oceania

• Gene Location: Start: 4315; End: 5148 Strand: -

Full Sequence      

MCRAQRTLAEEISFEGVGIHTGKSSHLTIKPAPTDHGIVFFSGGEYIPATYEYVVSTKRS
TSLGKGQVVVGTVEHLLAALSGLSIDNALIEIDGPEVPILDGSALPFCQAMEKAGIVNQD
GSEVEDYYIEEPIFVAEGEGLVLAMPDSQYNLEGAVSYASEQVGSQRFRYCGYDNFVTHV
APARTFGFWSEVKTLLENGLGQGGDLSNALIYDRPGFDVKKSQRFVNEPVRHKVLDLAGD
LCLLGRPLRAFVLAVRAGHKLHVEFVRKVAEEMRKNA

Enzyme Prediction     

No EC number prediction in MGYG000000541_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	5	270	5.5e-89	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	2.18e-121	5	271	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	2.23e-111	5	272	4	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
PRK13188	PRK13188	2.55e-102	1	277	1	306	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
COG0774	LpxC	2.13e-100	3	271	2	277	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	5.59e-74	5	274	3	276	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACK42101.1	3.81e-66	3	273	12	279
ACI20066.1	8.99e-66	5	272	4	268
AFN75113.1	7.34e-65	1	269	1	300
QSV67920.1	1.11e-64	5	271	3	280
QOV23936.1	1.40e-64	5	271	3	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1P42_A	6.67e-59	5	274	3	267	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1P42_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus]
2IER_A	6.87e-59	5	274	4	268	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IER_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2J65_A Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2J65_B Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2O3Z_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2O3Z_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],3P76_A X-ray crystal structure of Aquifex aeolicus LpxC complexed SCH1379777 [Aquifex aeolicus],4U3B_A LpxC from A.Aaeolicus in complex with the MMP inhibitor 4-[[4-(4-chlorophenoxy)phenyl]sulfanylmethyl]tetrahydropyran-4-carbohydroxamic acid - compound 2 [Aquifex aeolicus VF5],4U3D_A LpxC from A.Aaeolicus in complex with 4-[[4-[2-[4-(morpholinomethyl)phenyl]ethynyl]phenoxy]methyl]tetrahydropyran-4-carbohydroxamic acid (compound 9) [Aquifex aeolicus VF5]
2JT2_A	7.50e-59	5	274	4	268	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],5DRO_A Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRO_B Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRP_A Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5],5DRP_B Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5]
3P3C_A	7.50e-59	5	274	3	267	CrystalStructure of the Aquifex aeolicus LpxC/LPC-009 complex [Aquifex aeolicus]
5U86_A	7.72e-59	5	274	4	268	Structureof the Aquifex aeolicus LpxC/LPC-069 complex [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9Z7Q2	3.22e-62	3	273	4	280	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Chlamydia pneumoniae OX=83558 GN=lpxC PE=3 SV=1
Q1D2K0	1.15e-61	5	272	8	279	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxC PE=3 SV=1
Q8YUR5	2.42e-61	5	269	3	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=lpxC PE=3 SV=1
Q3MH15	3.43e-61	5	269	3	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=lpxC PE=3 SV=1
Q8DI02	5.61e-61	5	272	15	283	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Thermosynechococcus vestitus (strain IAM M-273 / NIES-2133 / BP-1) OX=197221 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000541_00623.