CAZyme Information: MGYG000000538_00029

Basic Information

• Species: UBA1829 sp900549045
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp900549045
• CAZyme ID: MGYG000000538_00029
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000000538_1|CGC2	43663.48	9.7481

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000538	3384359	MAG	Fiji	Oceania

• Gene Location: Start: 31707; End: 32876 Strand: +

Full Sequence      

MNRGRKEIWIIAGEASGDLYGARIASEIRRRRPDVVVCGMGGVEMRKAGVELLVDSCELG
VIGLIEVLENIFKFIRIFLYLIREAKKRRPLEVILIDYPGFNIRFAKAMWKAGIPVVWYI
SPQVWAWRRGNIRKLARYCRKLMVIFPFEPEVYEGSGLDVEFVGHPLVDIVKGRADATIE
RDPNTILLLPGSRKKEIEYLLEPFLKTAAILKSRNPELQFVVASPRERILQMVRDGIQTF
MTKHPDYPLPKIELTRGKTAFWMQRCTAGLAASGTVTVECAIAGIPLVVAYRLNQITFLL
ARLIIGRLFRGFFTMPNIILNRCAFEEFLQFQVVPEDLADAMERILPGGSRRAQAEQDMN
DVVVQLSGGASGAIAKAAACALSAIPAEK

Enzyme Prediction     

No EC number prediction in MGYG000000538_00029.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	363	8e-107	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.39e-119	8	358	4	351	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.89e-109	6	358	2	354	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.84e-88	8	366	1	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.16e-77	1	349	1	348	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.88e-46	53	344	42	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	1.14e-145	1	378	1	379
AVM45461.1	1.84e-126	5	378	11	385
QHI67954.1	1.80e-73	5	353	2	345
ADW17729.1	4.04e-72	6	385	9	387
QQG66459.1	6.02e-72	6	383	14	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.11e-43	8	349	9	348	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.94e-43	8	349	9	348	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	4.57e-67	6	369	7	366	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2LVL8	1.28e-66	6	385	4	378	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B8JE78	3.91e-65	7	357	10	354	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	2.16e-64	7	357	10	354	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	1.19e-63	7	357	10	354	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000538_00029.