CAZyme Information: MGYG000000526_01041

Basic Information

• Species: Prevotella sp900770395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770395
• CAZyme ID: MGYG000000526_01041
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000000526_4|CGC3	36648.91	8.2744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000526	3510035	MAG	Fiji	Oceania

• Gene Location: Start: 190405; End: 191382 Strand: +

Full Sequence      

MKKKLIALAAMAMTAITGMAASQYDNPDTIVVSRDGTGQFRTVDEAIEVCRAFMDYHKVI
YVKNGTYKEKLVIPAWLQNIEICGESKEGTIITWDDHANIKIPGTDRNMGTFRTYTVKVD
GSMITFKNITIENNAAKLGQAVALHTEGDKLVFINCRILGNQDTIYTGRAGTRLFFKDCL
IEGTTDFIFGPSTAWFENCDIFSRTNSYITAASTPKDVAVGYVFNNCRLTCAEGVDKVYL
GRPWRDYGYTLFMNCDMGKHIRPEGWHHWQKERMSTARYLEYNNRGEGAATANRATWSKL
LTKKEAAKITIENVFGINDKWIPTI

Enzyme Prediction     

No EC number prediction in MGYG000000526_01041.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	314	8.6e-100	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.94e-77	30	313	2	293	Pectinesterase.
PLN02773	PLN02773	2.41e-66	32	308	9	289	pectinesterase
PLN02197	PLN02197	2.05e-63	3	322	253	577	pectinesterase
PLN02745	PLN02745	3.68e-59	30	312	287	576	Putative pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	2.95e-58	30	322	13	292	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	4.70e-179	1	323	1	322
ADE82952.1	4.70e-179	1	323	1	322
QJR97878.1	8.66e-160	13	323	5	318
BCS84477.1	3.18e-159	1	325	1	325
QNT66521.1	1.45e-153	3	316	2	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	9.74e-45	30	322	9	308	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.14e-41	31	297	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	4.00e-41	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.17e-40	30	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.84e-31	33	325	12	341	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	4.27e-56	29	313	272	565	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	4.70e-55	29	316	276	572	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	7.07e-54	29	313	259	552	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q5MFV8	4.00e-52	29	316	283	579	Pectinesterase 5 OS=Arabidopsis thaliana OX=3702 GN=PME5 PE=1 SV=2
Q8GX86	1.52e-51	20	323	246	555	Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana OX=3702 GN=PME21 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999033	0.000184	0.000166	0.000157	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000526_01041.