CAZyme Information: MGYG000000526_00387

Basic Information

• Species: Prevotella sp900770395
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770395
• CAZyme ID: MGYG000000526_00387
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		43101.44	8.9465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000526	3510035	MAG	Fiji	Oceania

• Gene Location: Start: 488283; End: 489407 Strand: +

Full Sequence      

MNIIKSTLAVAAMAFSLTAGAQTTSAQSVLQTMQKVNNRFMDNYADPTRATLVKRMRPSS
LWTRAVYYEGLMALYEIDADKRYIDYTDRWANFHEWTPRKGVTTCDADDQCCSQTYLARY
MQSGGEEKIAKVRENLDLQMKTKIGWWTWIDAIQMAMPVYAQMAKITGERKYMNHAMKMY
TWTRDTLAGGLFNKKEGLWWRDKEYVPPYKESDGANCYWSRGNGWVYATYVRVLNQLDKK
DKYYKPLLKDFQMMTKALVKCQREDGFWNVSLTSKTAYPGIELTGTALFLYGMSWGINRG
YLSEKTYKPICDKIWAAMVKECVHDNGFLGWVQGTGKDPSAGQPLSYDKMPDFEDYGTGC
FLLGGAEYYKLINK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	370	2.4e-74	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.94e-82	32	371	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.70e-45	22	371	1	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85005.1	1.90e-185	27	374	22	368
AGB29883.1	1.88e-175	17	373	13	371
QVJ80547.1	4.73e-174	24	373	19	387
QGT72529.1	1.84e-141	16	371	10	372
QUT69872.1	6.45e-141	19	371	22	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q88_A	1.16e-59	23	373	10	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
5NOA_A	5.72e-59	25	374	29	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4CE7_A	5.80e-44	62	371	53	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
3K11_A	1.98e-15	66	373	86	415	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	3.70e-43	62	371	60	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	5.18e-43	62	371	58	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	8.30e-40	59	367	89	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000445	0.998698	0.000266	0.000213	0.000184	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000526_00387.