CAZyme Information: MGYG000000523_01445

Basic Information

• Species: UBA1221 sp900770525
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA1221; UBA1221 sp900770525
• CAZyme ID: MGYG000000523_01445
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		41967.27	8.9887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000523	1958836	MAG	Fiji	Oceania

• Gene Location: Start: 45808; End: 46932 Strand: +

Full Sequence      

MKKIFIITGDYSGDIHAGCVVEALKSLSSDIQIEGVGGENLKNAGVKLLCDQSKMGVVGL
SPKIIFDHILLGKKIVDYLTKEYKPDLVLLIDYGGFNLKISKVLKRAGIRIFYYIPPQVW
ASRKWRINAIKKNIDEVLCIFPFEKGLYESHGIKTHYCGHPLVSQLPAPADKSEFFKKHG
LDTNRKLVSIFPGSRDFELKNLAKVFVKSAKDLQRKHPELQFCISHAPNLSDEVYDKYFK
DTDFKIIKGENQALLSVSDALILASGTVALEATLYQTPMIIAYKGPILFYLIYLLVRCIN
MVCLPNIISGKFIVPEILEQNVTVHKISYNIEKLLYDKKAREEQIEGLTGVKDLLSDKIS
SQEAAKEIVTALGL

Enzyme Prediction     

No EC number prediction in MGYG000000523_01445.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	353	1.5e-101	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	9.77e-112	1	373	1	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.94e-98	1	369	1	376	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.55e-72	4	340	1	348	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.74e-65	4	344	8	355	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.29e-46	1	340	1	320	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	3.37e-199	1	372	1	372
QQG66459.1	6.79e-73	2	365	14	384
QBA65008.1	1.63e-72	3	373	2	371
QMU61387.1	1.72e-72	2	366	11	378
QAT16377.1	6.07e-72	2	373	3	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.94e-46	4	339	9	349	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.90e-45	4	339	9	349	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.54e-70	3	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	1.93e-68	2	373	7	381	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q5ZVR9	3.83e-68	2	356	5	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=lpxB1 PE=3 SV=1
B6J161	1.71e-67	2	368	4	370	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q5WWX7	2.13e-67	2	356	5	363	Lipid-A-disaccharide synthase 1 OS=Legionella pneumophila (strain Lens) OX=297245 GN=lpxB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000523_01445.