CAZyme Information: MGYG000000523_00954

Basic Information

• Species: UBA1221 sp900770525
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA1221; UBA1221 sp900770525
• CAZyme ID: MGYG000000523_00954
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000000523_2|CGC3	23520.53	10.0731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000523	1958836	MAG	Fiji	Oceania

• Gene Location: Start: 294765; End: 295421 Strand: -

Full Sequence      

MKKLLLFTITLVLLCVAPVQAADVNTVKATIVKHAIEMGVDPAIALSIARTESGFSHSAR
SSHGAVGVFQLMPSTARRMGLNPYSLNDNIKGGIMYYKSMYKMFGSVELALAAYNAGPGN
VKRYNSVPPYAETKRFVSKIMKDYHYYKANPDPALVKARAASTAAHKPVAKPTVTANKPK
APVPSMELVKAKDVNAIKVEVVDETPIDLEIEATSLAI

Enzyme Prediction     

No EC number prediction in MGYG000000523_00954.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	40	147	1.4e-27	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13401	Slt70-like	1.09e-38	28	149	7	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	2.45e-38	28	144	5	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.22e-37	42	144	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	3.75e-28	31	149	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.15e-25	39	126	9	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	1.39e-92	1	218	1	216
ADI02565.1	7.26e-32	25	141	90	207
ABB14930.1	8.30e-32	43	150	75	183
ALF17355.1	1.69e-30	18	145	38	167
AUW94962.1	3.52e-30	18	154	41	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.19e-15	24	149	413	557	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.19e-15	24	149	417	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.20e-15	24	149	427	571	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.20e-15	24	149	433	577	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.20e-15	24	149	423	567	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	5.69e-27	26	145	59	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	9.02e-25	35	144	1430	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	9.02e-25	35	144	1430	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	4.85e-11	30	158	10	133	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000223	0.999107	0.000184	0.000165	0.000154	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000523_00954.