CAZyme Information: MGYG000000523_00566

Basic Information

• Species: UBA1221 sp900770525
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA1221; UBA1221 sp900770525
• CAZyme ID: MGYG000000523_00566
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		62357.2	9.4596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000523	1958836	MAG	Fiji	Oceania

• Gene Location: Start: 566405; End: 568024 Strand: -

Full Sequence      

MKKILLSKKVMFCVLGFIVTYLLFFHNMWAYDLMDVDETRYIDMARHMIKSHDYLTLYMN
GNYFFEKPPLFFWIENIGFLLFGKVSSGLARLPIAIEALLACCAVYYACQKAVSKKFGLV
AAIIAGSCLEFLILSKVAILDMLLTSCITISTFAGLTTFFVKEENKKYFWWVFYIFSALG
VMAKGIPAFIVPFGTMFFAGLYTKKLKEYFRPIYMLPGILVFLLIVIPWHYVMLAKYKHL
FFDEYIILHHIKRFLGSAVLDKNRPFYYYFAVVIWGFFPWIFSFIPALVNKIKGFKFTPY
ESLTQEQQFVALNAIGLVFTFLFFTSSSSKLVTYILPVYPFMAVLLADYWLKKGFSKGLK
YSSTILSSIILFVGIGGCFLKFVMPNNLYEIIKEAQSFSCILCLVIGGLSFYYIKKSEKT
KLFATYFIFMTLFSAFGAYHLFNIDYKFGQDDLENFAVYAKDTNRKLGSWNTGRKYSLTY
MYEDNVTFLVDVPSDTIKPLLDNNYLVIVRNKDMDEIQKGISYKIIATGAKYSLIEKLN

Enzyme Prediction     

No EC number prediction in MGYG000000523_00566.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	13	493	9.6e-97	0.8759259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.60e-40	2	389	1	378	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	6.81e-28	14	377	12	359	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	3.14e-07	10	239	1	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	5.01e-07	67	229	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38667.1	4.14e-149	18	536	22	555
ACM19911.1	6.80e-42	24	439	30	431
AHF98085.1	3.79e-41	8	422	6	401
QCT94029.1	1.90e-40	24	414	18	387
AJQ27709.1	1.58e-39	18	434	14	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.15e-20	33	345	54	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.04e-23	22	491	14	436	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	7.94e-23	18	376	10	329	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
C6DAW3	6.76e-20	1	347	1	332	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
Q6D2F3	1.60e-19	1	347	1	332	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
B7LM74	3.63e-18	7	354	3	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.710569	0.272810	0.009311	0.001277	0.000962	0.005082

TMHMM  Annotations     

start	end
12	31
88	110
117	134
139	161
168	190
210	232
266	288
308	325
332	351
361	383
395	412
422	444