CAZyme Information: MGYG000000468_01277

Basic Information

• Species: UMGS1696 sp900554225
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS1696; UMGS1696 sp900554225
• CAZyme ID: MGYG000000468_01277
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		26899	6.8272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000468	2935049	MAG	Fiji	Oceania

• Gene Location: Start: 12007; End: 12702 Strand: -

Full Sequence      

MLPKIIHYCWFGRGEKPVLAQKCIDSWRKFCPDFEIREWNEDNCDYLTMPFMMEAYAAKK
YAFVSDVMRLIVLEQYGGVYFDTDVELVRDLAPLMDDEGFIGFENDQYVNSGQGIAAMPH
HPVVQAMIEEYRKLHFTSADGTINAVGCPHLNTDVMERYGLVRNGKEQRVAGIHVYPAEF
FNPLDSVTGKLTKTENTYSIHWYSMSWLPKSVQIRSRMGRMVRRIMKEIKR

Enzyme Prediction     

No EC number prediction in MGYG000000468_01277.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	96	2.7e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.62e-22	1	131	81	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	4.51e-18	17	100	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	2.47e-15	3	127	47	184	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.001	61	84	170	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO34420.1	6.50e-151	1	230	1	230
ANU77720.1	2.52e-83	1	226	1	222
QJU16510.1	2.52e-83	1	226	1	222
ASU30521.1	2.52e-83	1	226	1	222
QQQ95316.1	2.52e-83	1	226	1	222

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	3.44e-07	2	95	57	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000468_01277.