CAZyme Information: MGYG000000464_00695

Basic Information

• Species: QHMH01 sp003258795
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; QHMH01; QHMH01 sp003258795
• CAZyme ID: MGYG000000464_00695
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000000464_2|CGC2	32187.04	7.819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000464	1534068	MAG	Fiji	Oceania

• Gene Location: Start: 155232; End: 156047 Strand: -

Full Sequence      

MTESIPKIIHYCWFGSNQQPDIVIKCIESWKNILSDYEFREWNNEDLKLCNNKYVNDALK
EKKWAFISDYFRIYALYNYGGIYLDTDCMVFKPLDDFLNLNFFCGFENLHRRILPATGVV
GAKKNNHIIKDLLDEFDNLNFYNEDGSLNLIPNTERLQVYFAEKFNLKPPYNDKKTVELE
DKSYIYPSNYFSNYDKNVSYIKHFYCGSWLPPLRELITFNILGCYFRFYGIDKGYFFKEI
KNIKEQILMVCPRIIKSTVVLTVGKNNLGKK

Enzyme Prediction     

No EC number prediction in MGYG000000464_00695.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	23	99	5.9e-22	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	3.20e-13	20	96	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	1.25e-12	5	98	82	178	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	3.92e-09	3	204	44	278	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.009	68	89	174	195	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM65043.1	4.08e-73	3	215	2	215
QIM63303.1	1.37e-71	1	221	1	221
BBV10505.1	1.52e-69	5	215	2	212
AIN65396.1	1.52e-69	5	215	2	212
QUC06113.1	4.59e-69	4	249	2	261

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000464_00695.