CAZyme Information: MGYG000000424_02682

Basic Information

• Species: CAG-353 sp900768995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-353; CAG-353 sp900768995
• CAZyme ID: MGYG000000424_02682
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205		23144.49	9.6454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000424	2854163	MAG	Sweden	Europe

• Gene Location: Start: 7438; End: 8055 Strand: -

Full Sequence      

MRKNFHMKKYLDTTLTPQERAEALADEMTVEEMAGQLRFDAPAIDRLGIPAYNWWNEGLH
GLARSGTTTMFPQAIALAAMFDTELVRKAGEITSLETRAKYSTYSKHGDRDIYKGLTLWA
PNINIFRDPRWGRGHETYGEDPYLTAENGKAYVKGLQGEEKLSVQPPAQSILQSTAAPKL
SATSLMHRCPKRSLKKHIFPHLKPL

Enzyme Prediction     

EC	3.2.1.37	3.2.1.-	3.2.1.21	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	44	161	5.3e-34	0.46296296296296297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03080	PLN03080	1.22e-43	10	161	42	196	Probable beta-xylosidase; Provisional
COG1472	BglX	6.82e-27	41	159	52	159	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.59e-23	21	164	39	168	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	5.11e-22	15	159	29	195	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04977.1	2.65e-83	7	162	1	156
AEE64772.1	5.64e-82	7	162	1	156
ADU23372.1	1.11e-81	7	162	1	156
CBL17962.1	7.29e-75	5	162	4	161
CBK95705.1	1.05e-71	7	205	1	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC7_A	6.55e-32	17	158	22	168	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC6_A	6.55e-32	17	158	22	168	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
6Q7I_A	4.51e-25	12	158	44	190	GH3exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7I_B GH3 exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7J_A Chain A, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4],6Q7J_B Chain B, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4]
5AE6_A	4.51e-23	19	158	51	192	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5AE6_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]
5A7M_A	4.51e-23	19	158	51	192	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5A7M_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY15	1.69e-41	10	160	24	176	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
Q9SGZ5	1.79e-35	9	159	37	190	Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BXL7 PE=2 SV=2
Q9LXD6	6.26e-35	9	157	48	198	Beta-D-xylosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BXL3 PE=1 SV=1
A5JTQ2	8.55e-35	3	157	45	203	Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia OX=36902 GN=Xyl1 PE=1 SV=1
Q5ATH9	2.92e-34	12	160	40	191	Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bxlB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000424_02682.