CAZyme Information: MGYG000000424_01081

Basic Information

• Species: CAG-353 sp900768995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-353; CAG-353 sp900768995
• CAZyme ID: MGYG000000424_01081
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		50397.69	4.9672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000424	2854163	MAG	Sweden	Europe

• Gene Location: Start: 99124; End: 100488 Strand: -

Full Sequence      

MNSERLNIAYIGGGSCNFGWKLIPELANTDLCAMVKLYDTDKTCALANEVIGNNIHDRGN
TRGDIVYLACDEAEEALRDADFVILAFEPGTLDEQVSQLHLPETYGIFQTGGENSGLSSV
IRALKIMPLCAEYSHMIEHLCPNAWVINLCTPMAECMTVLHNEFTEMKLVGASSDTFAAR
ELIASMVCEKKEISGVRRRDIKTNVMGISGFSWFDDITYEGGSLMPMFREYAEKYGDSGY
EFRINEYKSNPDADGHRVKFDLFLRFGLIPAVIDRCAAEFCPPWYTKDTKGMAAWKFSPV
TVNYRKKMLGDKTSKVKKYMNGDVLPKSADATEVPEMIRALCGGGNLISAVSLPNRGQVE
NLPAGAIVETNALISRDSVRAVCAGRLPDSIAGLSVRHVYNRSAVVKAFEERDLDIAFNA
FLNDPLMTCGLTEATELYREMLSGIRTHLLYYCE

Enzyme Prediction     

No EC number prediction in MGYG000000424_01081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	8	186	6e-32	0.9832402234636871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	3.93e-81	8	426	3	405	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	2.76e-55	8	442	6	429	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam11975	Glyco_hydro_4C	2.96e-31	207	427	3	168	Family 4 glycosyl hydrolase C-terminal domain.
cd05197	GH4_glycoside_hydrolases	1.68e-30	6	426	1	408	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
PRK15076	PRK15076	4.16e-27	8	442	4	420	alpha-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC67847.1	1.81e-125	6	449	11	457
ANX00783.1	1.81e-125	6	449	11	457
ANW98258.1	1.81e-125	6	449	11	457
AGI38887.1	1.81e-125	6	449	11	457
SNX53414.1	1.99e-119	4	449	9	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	9.27e-95	4	445	4	439	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	2.71e-13	66	449	68	434	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	1.49e-11	4	449	6	437	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	1.86e-08	6	425	4	449	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	1.39e-115	6	449	11	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.01e-103	4	449	9	450	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	8.15e-98	4	445	8	443	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
A9KTB9	3.28e-96	6	449	11	460	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
O34645	7.67e-24	8	432	4	409	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000424_01081.