CAZyme Information: MGYG000000410_01541

Basic Information

• Species: Zag111 sp002102825
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; Zag111; Zag111 sp002102825
• CAZyme ID: MGYG000000410_01541
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000000410_7|CGC1	79950.55	5.3514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000410	1882952	MAG	Sweden	Europe

• Gene Location: Start: 20133; End: 22199 Strand: -

Full Sequence      

MMFNKNKKKRVIAYLHSHWDREWYREFEVFRLRLVRVFDNILKYLEEDKIPSFYFDGQVV
ALLDYLEFRPEKEELVKRFIKDKRLFIGPFYCLVDEFLTDGICFRKNIEIGTKIAKSLGC
EDFIGYFADTFGHSKNIPTILKEYGIDKAMVWRGCCDELQSEFIFNGVNTVNLIRGYFMD
IFSSDISMQEKANFLKTNLDKIAEKSGETLLLPIGADHLAIPEDIKSQIESVNFYLDDYE
IELGSPFDYFGTVKFKQKYDGELRDNSKTFILQGSYSARTKLKQLNTECSYKLDLADKIQ
LNFGNNYEKAIEYAYKLLLQNQAHDSICGCSTDLVHKENITRYHKILEITDTIINEIGVT
QPENMSITFKYLDKYKLLTVEKDKIDENSQVLSKRKGFPKSLLYDIKKIPVTEDYTTIYT
LLKEFNGTNDVTDLEIQNDMLFNSNIKIELKDGKLNLYTAGKCYENFIEFVRYKDNGDTY
NFGPVENDLGEVAEIKSAKILMNGDLRSTIRVSTSFFNVDISLNKKSHLLNFKVKWLNLL
TNKLWQVRFNTQEPIIKTYSEDMNLLLERKFNPEYEIRKNLPKEKGIEAMTNTAPLQRFV
WANGLGIITKGLTEYEVQQDKLAITLLRSTGIISNPQNPARLTPAGPPIEVPEAQQIGEN
IAEFSIGFFDVREWANYVEEVYPQTVLF

Enzyme Prediction     

No EC number prediction in MGYG000000410_01541.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	11	258	4.2e-43	0.9405204460966543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09819	PRK09819	2.16e-70	7	669	2	747	mannosylglycerate hydrolase.
cd10814	GH38N_AMII_SpGH38_like	2.56e-65	16	267	7	271	N-terminal catalytic domain of SPGH38, a putative alpha-mannosidase of Streptococcus pyogenes, and its prokaryotic homologs; glycoside hydrolase family 38 (GH38). The subfamily is represented by SpGH38 of Streptococcus pyogenes, which has been assigned as a putative alpha-mannosidase, and is encoded by ORF spy1604. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. A divalent metal ion, such as a zinc ion, is required for its activity. SpGH38 is inhibited by swainsonine. The absence of any secretion signal peptide suggests that SpGH38 may be intracellular.
cd10815	GH38N_AMII_EcMngB_like	2.18e-59	16	265	7	268	N-terminal catalytic domain of Escherichia coli alpha-mannosidase MngB and its bacterial homologs; glycoside hydrolase family 38 (GH38). The bacterial subfamily is represented by Escherichia coli alpha-mannosidase MngB, which is encoded by the mngB gene (previously called ybgG). MngB exhibits alpha-mannosidase activity that converts 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. A divalent metal ion is required for its activity.
cd10790	GH38N_AMII_1	4.13e-45	16	279	7	272	N-terminal catalytic domain of putative prokaryotic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). This mainly bacterial subfamily corresponds to a group of putative class II alpha-mannosidases, including various proteins assigned as alpha-mannosidases, Streptococcus pyogenes (SpGH38) encoded by ORF spy1604. Escherichia coli MngB encoded by the mngB/ybgG gene, and Thermotoga maritime TMM, and similar proteins. SpGH38 targets alpha-1,3 mannosidic linkages. SpGH38 appears to exist as an elongated dimer and display alpha-1,3 mannosidase activity. It is active on disaccharides and some aryl glycosides. SpGH38 can also effectively deglycosylate human N-glycans in vitro. MngB exhibits alpha-mannosidase activity that catalyzes the conversion of 2-O-(6-phospho-alpha-mannosyl)-D-glycerate to mannose-6-phosphate and glycerate in the pathway which enables use of mannosyl-D-glycerate as a sole carbon source. TMM is a homodimeric enzyme that hydrolyzes p-nitrophenyl-alpha-D-mannopyranoside, alpha -1,2-mannobiose, alpha -1,3-mannobiose, alpha -1,4-mannobiose, and alpha -1,6-mannobiose. The GH38 family contains retaining glycosyl hydrolases that employ a two-step mechanism involving the formation of a covalent glycosyl enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst. Divalent metal ions, such as zinc or cobalt ions, are suggested to be required for the catalytic activities of typical class II alpha-mannosidases. However, TMM requires the cobalt or cadmium for its activity. The cadmium ion dependency is unique to TMM. Moreover, TMM is inhibited by swainsonine but not 1-deoxymannojirimycin, which is in agreement with the features of cytosolic alpha-mannosidase.
COG0383	AMS1	1.07e-40	7	685	2	846	Alpha-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR37692.1	4.43e-284	8	684	18	656
ANC78687.1	3.98e-76	16	666	12	732
ARR44603.1	2.77e-70	8	660	3	733
QLK43823.1	3.82e-70	8	660	3	733
CAE6908833.1	1.38e-69	8	660	3	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WYH_A	3.18e-48	9	631	26	781	Structureof the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYH_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase [Streptococcus pyogenes M1 GAS],2WYI_A Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS],2WYI_B Structure of the Streptococcus pyogenes family GH38 alpha-mannosidase complexed with swainsonine [Streptococcus pyogenes M1 GAS]
5KBP_A	2.31e-47	4	631	2	755	Thecrystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],5KBP_B The crystal structure of an alpha-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
3LVT_A	1.97e-45	4	631	2	755	TheCrystal Structure of a Protein in the Glycosyl Hydrolase Family 38 from Enterococcus faecalis to 2.55A [Enterococcus faecalis V583]
5JM0_A	4.34e-06	16	356	309	672	Structureof the S. cerevisiae alpha-mannosidase 1 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KER1	1.68e-46	8	358	2	382	Putative mannosylglycerate hydrolase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=mngB PE=3 SV=2
Q54K67	1.66e-09	4	356	250	611	Alpha-mannosidase G OS=Dictyostelium discoideum OX=44689 GN=manG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000410_01541.