CAZyme Information: MGYG000000406_01284

Basic Information

• Species: UBA10677 sp003533505
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UBA10677; UBA10677 sp003533505
• CAZyme ID: MGYG000000406_01284
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474		53536.42	4.8435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000406	1936952	MAG	Sweden	Europe

• Gene Location: Start: 58288; End: 59712 Strand: -

Full Sequence      

MNRLKKIGKIKTYNSDEISFMKFGIGLEKLDRNMFEPKQTYEPLQKSGVKYVRLQSGWQR
TEKTKGVYDFGWLDEVVDELVSRGMTPWLCLCYGNELYTEAAKKQFGAVGVPPIFADEDK
AAWRAYCRAVAEHYKGRVSLYEVWNEPDGVWCWKHGPSGTEYGNFVIETAKAVKEGDGDA
KIAAGSIYSVYHSPGWVHDMCETGACDYIDYITYHEYTRREKEVPNTVNYLSALLNRYNP
SVKIIQGESGSPSEPEGNGAMCRGNWSQDKQAKLLLRRLVVDLNTEVEFTSWFTTVDMSE
ALYGENGNVASYLDYGYFGVLGAQFDAEGKSIGTFEPKKSYYALKNLCGLFGKTGAEPTK
LPVFPMGEHYTERVFGYTVAGRELTAYGFRKPNGSSALFYYKSTDLMTETFEGLTSLTVD
MPEEKVRLVDPMDGSVYELPSGMKKQDGGVYLLDEIPVRDYPLVLTFGDFFEEE

Enzyme Prediction     

No EC number prediction in MGYG000000406_01284.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	59	223	9.9e-32	0.39211136890951276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	5.37e-10	45	220	44	229	Glycosyl hydrolases family 39.
pfam02449	Glyco_hydro_42	1.16e-06	45	149	20	140	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
smart00633	Glyco_10	1.47e-04	58	181	3	124	Glycosyl hydrolase family 10.
pfam13204	DUF4038	0.001	73	204	86	204	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam00331	Glyco_hydro_10	0.003	58	181	46	164	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY35369.1	1.27e-152	1	470	1	473
AWI10371.1	1.54e-150	3	474	60	532
AVM45335.1	2.54e-141	1	470	10	477
QNN22730.1	1.21e-69	4	466	47	479
QDK81919.1	2.60e-66	4	465	44	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4EKJ_A	1.83e-06	48	217	55	231	ChainA, Beta-xylosidase [Caulobacter vibrioides]
4M29_A	1.83e-06	48	217	55	231	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
1W91_A	5.61e-06	65	220	74	233	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	5.61e-06	65	220	74	233	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000406_01284.