CAZyme Information: MGYG000000393_00851

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000000393_00851
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		62346.91	4.8585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000393	2242585	MAG	Sweden	Europe

• Gene Location: Start: 29; End: 1708 Strand: -

Full Sequence      

MNIKSTAVLLMLLSACVRLAASEPAKVRINGYIGDRIDLCIAGRVMTQDVDELVEPFRHR
DDSWSWKTEFIGKWMLGAINSYRYCPQPELMEKIRHAAEALMDTQDGDGYIGNYTAEARL
TNWDIWGRKYTALSLLAYYRISGDMNALDAVSKSIDCLIRELRDRNMDIARTGNYFGMAS
CSILEPVVYLYRETGNRDYLEFAERIVESIEKENSAQLISKALADIPVSERSKFPSSWWS
FENGQKAYEMMSCYEGLMELGTVTGNRDYIEAACRTAGSIIRDEINVAGSGAAFECWYMG
RARQTVPTYHMMETCVTFTWMQFCARMLERTQDGMYADQFEKTMYNALMASMKDDGSQIS
KYSPLEGHRHQGEEQCGLHINCCNANGPRGFALIPQVAYRVSDSAVAVNLYLPSCASFSI
GRNNVSLTVDTGYPVDGKAVIGISTKKPTYFTLALRVPGCAASGFMVRVNGEAEDAVPEK
GYVCLSRKWKDGDTVEICMDIRTEVLVMNNAQAVVRGPVVFARDCRFADGHVDETAVIQC
NEDGVVDAVPSVAVEGSFQ

Enzyme Prediction     

No EC number prediction in MGYG000000393_00851.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	64	522	6.9e-59	0.9045801526717557

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	4.51e-63	49	522	24	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.55e-56	26	531	16	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	7.92e-06	132	275	500	678	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
cd04791	LanC_SerThrkinase	5.58e-05	46	209	61	233	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG4225	YesR	0.003	91	275	1	162	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	4.31e-227	26	558	26	558
ACM22580.1	3.30e-37	11	524	1	536
QGK76121.1	4.50e-37	77	522	114	595
AMM85914.1	1.78e-36	26	521	24	555
AIY87981.1	2.02e-36	18	521	14	531

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.58e-33	59	524	60	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	2.00e-21	73	521	105	606	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000203	0.999137	0.000212	0.000153	0.000136	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000393_00851.