CAZyme Information: MGYG000000388_01899

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1623
• CAZyme ID: MGYG000000388_01899
• CAZy Family: GH156
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580		65543.64	4.8768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000388	2362060	MAG	Sweden	Europe

• Gene Location: Start: 883; End: 2625 Strand: +

Full Sequence      

MKKAAACLLAAFLCLVSVSGCKPSSNPGSSDLSEEPGSAPAESGTGEPGEITVGDPTFYP
VIYNSDTTHIYQNVSPYHKALNDPLTPEMFDAAVKEAADAGANCFEITPGHCWVPWWPSE
AFPVAEHARWFINDFKGTMVSNPFYDYVFKAPNSLPYRNYRDFIQEQIESCRKYGMGAFI
NFRLNDAHMIMKTTPDLANIAFASPLYIEHPEYAIGEIQGYKDKYVYVLDWRHKEVRDNR
LTMIKELIANYEIDGFELDFMRRFCFFNTDKCTKEERVSIMTEFLREVRAALDEASAKDG
RYRYLSVRIPAYTDTYGDMGIDIKAWQEAGVGIFNLASSYFVDQDTDIRTVKETVGNDAL
VYMELTHTTACGYENGEKGNQTRIHRRTTPEQFYTSALLGYAQGADGISLFNFQYYRGDR
MGTGDAPLTEPPFDVIRHLGDKNYLKQAPQHYFYGETWCDPVKSGWQLPRTMMTGLSAEF
DMELVQPDGGWTQDGVYRLKANESFTNQRYTVTINGTKLQEIADAGEPYPNDYTQLLGTA
AQRKSYRVPRSILKEGTNTITVEQTAGSRIVLGFVDLAIR

Enzyme Prediction     

No EC number prediction in MGYG000000388_01899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH156	60	580	3.3e-61	0.9148550724637681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	7.46e-09	204	295	94	192	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06548	GH18_chitinase	0.002	282	322	155	195	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
COG3325	ChiA	0.004	234	322	149	237	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam14683	CBM-like	0.004	479	580	57	156	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI69840.1	1.28e-110	49	580	15	543
QIF01836.1	3.42e-101	51	578	38	557
QGJ71964.1	1.48e-78	56	579	41	550
QHI69841.1	1.07e-51	59	567	28	523
BCG53795.1	3.21e-28	122	580	78	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZD_A	6.57e-17	162	580	108	501	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6RZD_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 [uncultured bacterium pG7],6S00_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S00_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-acetylneuraminic acid [uncultured bacterium pG7],6S0E_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0E_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-Acetyl-2,3-dehydro-2-deoxyneuraminic acid [uncultured bacterium pG7],6S0F_A Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7],6S0F_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with 3-Deoxy-D-glycero-D-galacto-2-nonulosonic acid [uncultured bacterium pG7]
6S04_A	8.06e-15	162	580	108	501	Crystalstructure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7],6S04_B Crystal structure of an inverting family GH156 exosialidase from uncultured bacterium pG7 in complex with N-glycolylneuraminic acid [uncultured bacterium pG7]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000013	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000388_01899.