CAZyme Information: MGYG000000387_00692

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000387_00692
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444		51335.86	5.3394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000387	2488147	MAG	Sweden	Europe

• Gene Location: Start: 19025; End: 20359 Strand: -

Full Sequence      

MFKKPWDNGPLTISEDKRFMKNGDVPFFWLGDTAWLMFCTLTREEIDAYLRNRAEKGYNV
IQITIAHKWPTVTADGIDAFLDEDFTKPNTQKGGFWDLVDYTVQKAEEYGLYLGLLPIWS
GQFKAKRITEDNVEDYIQFLTDRYGKYPNIIWITGGDCKGTDGFDFWTKMGRKLKEQNPD
KLVTFHPFGRTVTCDYFPDSEWIDFYMFQSGHRRYDQKSLKKWDDSMTMGYFYGEDTYKY
IERVEKCGNPKPVLDGEPSYEHIPHGLHDPSQPFWQDYDVRRFAYWSVLAGACGFTFGHS
SIMQFYTGDGTEPGAYGCTINWKDAVHSPASDNMSKMAALMRSVPFEKGHAAQKLLAYKE
GLRYNRISAFAGEDFALFYDYTGRKIELNPNPVAGEYLDAWWFDPVSGTESYIGKFKQDC
ILTFAPPVGTFTHNDWVLKIKSAE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	9	438	3.9e-132	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	1.86e-113	16	343	1	319	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	1.47e-21	352	438	3	89	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO19127.1	5.65e-133	11	408	2	403
QDW24792.1	2.36e-132	3	441	22	464
QGY45591.1	3.05e-132	11	443	40	473
QNR86380.1	6.13e-130	3	441	22	464
QXU44072.1	8.68e-130	3	441	22	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.23e-113	5	440	12	444	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	8.97e-108	5	440	12	444	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	3.78e-103	5	440	25	460	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000387_00692.