CAZyme Information: MGYG000000379_01135

Basic Information

• Species: Eubacterium_R sp900539425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp900539425
• CAZyme ID: MGYG000000379_01135
• CAZy Family: GH33
• CAZyme Description: Sialidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		48764.22	8.7771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000379	2070552	MAG	Sweden	Europe

• Gene Location: Start: 47321; End: 48625 Strand: +

Full Sequence      

MEFKTVFGPQINGPSNFYRIPSLITAKDGVLIACADARYCSGMDNPNRIDKVIRRSFDCG
ETWEDAVIAVEEHGTKQMKSSAAIDPVMVYSKKSGRVILIYSHTPAGIGIRNSKVSRGED
ENGNKYIRGRFSKYILKGNRLYKRSGAQTPYTVKDNGDVVKDGKTVCNIFTGGRFKEEST
SYLMMVYSNDNGKTWSAPRSLNKMVKKDYMSFIGPGPGCGIEIKSGKYAGRLVVPVYFGT
RTFPLRLSCTVIYSDDGGETWTMGETPNNTRMINGKRADCMTIKQQDMLTESQLIEQEGG
RLKYFMRNHDKERSTAVAYSDNGGESWYDYRLDENLPQPICQMSVIKLEGTEKPTVIFIN
PADRQKRRNGTVRLSEDDGETFGWSRQIKDGDFVYSAAAQMQNGKIGVLFEPDNECREIK
FASFSTEWIKGNEA

Enzyme Prediction     

No EC number prediction in MGYG000000379_01135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	7	424	7.4e-93	0.9707602339181286

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.06e-93	5	425	2	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	2.20e-19	172	408	71	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.96e-16	15	414	272	703	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96375.1	1.79e-111	5	430	39	469
SQI63205.1	1.67e-105	1	430	4	445
QJA08933.1	3.42e-85	4	430	244	680
AKK05320.1	1.16e-81	4	429	331	762
QQA11681.1	2.89e-80	6	420	254	682

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	2.13e-83	6	420	13	441	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	6.01e-83	6	420	12	440	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	6.53e-83	6	420	12	440	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
2YA4_A	7.26e-59	2	432	26	493	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]
5KKY_A	7.74e-59	2	432	29	496	Structureof Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae],5KKY_B Structure of Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	8.42e-79	6	432	384	829	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62575	8.64e-55	2	424	325	781	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
P62576	8.64e-55	2	424	325	781	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
Q27701	6.18e-38	15	431	289	757	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
P31206	1.31e-26	1	411	184	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000379_01135.