CAZyme Information: MGYG000000366_00269

Basic Information

• Species: UMGS882 sp900757905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882; UMGS882 sp900757905
• CAZyme ID: MGYG000000366_00269
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209	MGYG000000366_1|CGC5	23889.28	5.3045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000366	2815847	MAG	Sweden	Europe

• Gene Location: Start: 324208; End: 324837 Strand: +

Full Sequence      

MEEKIYKHPYFGEIYYLADVPEKYKNKAGAPLVVFLHGAGERGRDHELLYRQGLPRYIRE
GIKSVDAITLCPQCPAEYIWNDIVLFLKDFIDSMIDEYQIDRKRVSLTGISMGGYGTWEM
AMCYPDMFRKIAPVCGGGTPWRAWLIQAKIRAFHGDLDDVVPPESSYQMVDAAQNAGKDA
SLTIFHRVNHGSWDPAYLTTNVIDWLTED

Enzyme Prediction     

No EC number prediction in MGYG000000366_00269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	20	175	1.4e-23	0.6475770925110133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	5.69e-31	6	208	165	384	Predicted peptidase [General function prediction only].
COG1506	DAP2	1.68e-12	1	208	365	608	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam00326	Peptidase_S9	8.22e-12	87	197	45	194	Prolyl oligopeptidase family.
COG3509	LpqC	8.66e-12	16	205	49	253	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG0400	YpfH	2.48e-11	17	208	4	204	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU56037.1	2.04e-38	16	208	803	1004
BCI61582.1	6.55e-35	16	206	827	1038
VTR91196.1	1.21e-31	13	206	42	234
QJW99051.1	2.95e-30	13	206	43	235
ABS60377.1	3.96e-26	31	206	38	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	1.65e-33	6	208	149	377	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	3.10e-24	16	206	23	212	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	3.18e-18	30	206	80	272	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000366_00269.