CAZyme Information: MGYG000000361_00201

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; VSOB01
• CAZyme ID: MGYG000000361_00201
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		39496.67	4.8101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000361	1916694	MAG	Sweden	Europe

• Gene Location: Start: 19; End: 1023 Strand: +

Full Sequence      

MLHLEETLCGFIDNDKRKQGTRKLIGGRKIPIYSFDEFVEMVDAETIVLTTSTYCPYMIE
QMDRENALDGLPCYIDFLVENIYSIQEIQWKKNGEMKIPKTIHYCWFGKNPIPDAFCKYM
QTWQDKCPDYQIVRWDESNYDVNNSDYIREAYKHKKWAFVSDFARLDIIYRYGGIYLDTD
VELLKNLDSLLYDEFFCGFEQNNYVNFGLGFGAVKGHPIVENLLRRYQKMKFELEDGSLN
ETACAVFQLEEIQNQGFQTENRFQRQNSCALYPSEVFAPHDLLGLQSFITENTVSIHHYS
STWWNKSAEISMDYLRTKLKEYRERIENYADKGC

Enzyme Prediction     

No EC number prediction in MGYG000000361_00201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	117	191	5.7e-22	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.44e-20	97	228	81	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.50e-19	113	196	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.74e-09	84	227	32	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92956.1	6.66e-88	2	329	39	363
BCJ92954.1	2.26e-74	6	327	43	358
BBF44126.1	2.47e-74	13	319	50	364
ACR71293.1	2.47e-73	6	323	46	362
QRT49775.1	3.02e-71	98	305	2	223

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	4.73e-11	79	232	41	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
Q5UQW4	2.32e-07	98	247	2	159	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
O14084	2.62e-07	94	229	59	201	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000361_00201.